SAXSdb — 2a8e

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

hypothetical protein yktB

Bacillus subtilis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	SULFATE ION × 2 DI(HYDROXYETHYL)ETHER × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q45498_BACSU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–212； UniProt 1–212

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2a8e
Deposition date deposition_date	2005-07-07
Structure title title	Three-dimensional structure of Bacillus subtilis Q45498 putative protein at resolution 2.5A. Northeast Structural Genomics Consortium target SR204.
Keywords keywords	;NESG, Q45498, yktB, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION ;; STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2a8e__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2a8e__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2a8e__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.19 Å
Rg (electron density)	16.87 Å
Total Rg	18.02 Å
Atom count	1740
Residues	205
Excluded volume	31108 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2a8e__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	hypothetical protein yktB
Molecular weight formula_weight	26002.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1835

MTQMRFTEEDFNTFTIEGLDARMEVLKETVRPKLTALGEHFAPTLSALTGDEMFPHVAKHARRSVNPPADSWVAFANSKRGYKKLPHFQIGLWESHVFVWFAIIYESPIKEEYGKLLEVNQETITKNIPDSFVWSADHTKPGVHKQSEMDKEQLKTLFERLQTVKKAELLCGIQLQKEEVLNMNNQEFLQRIDDAFKQLAFLYRLTQKVTQALEHHHHHH

Source Source

Source organism organism	Bacillus subtilis
NCBI taxonomy ID ncbi_taxonomy_id	1423
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	DI(HYDROXYETHYL)ETHER
Molecular weight formula_weight	106.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	95

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d2a8ea1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.296 — YktB/PF0168-like
Superfamily Superfamily superfamily	d.296.1 — YktB/PF0168-like
Family Family family	d.296.1.1 — YktB-like

CATH v4.4 (1 domains)

Domain ID domain_id	2a8eA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	930 — BirA Bifunctional Protein; domain 2
Homologous superfamily homologous superfamily	20 — Protein of unknown function DUF1054

▶

Unit-cell length a length_a	102.000 Å
Unit-cell length b length_b	165.449 Å
Unit-cell length c length_c	40.952 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	29.790 Å
R factor r_factor	0.1960
R_work r_work	0.1960
R_free r_free	0.2410

Three-dimensional structure of Bacillus subtilis Q45498 putative protein at resolution 2.5A. Northeast Structural Genomics Consortium target SR204.

1. Protein Identity and Related Structures Protein Identity & Related Structures

hypothetical protein yktB

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2a8e__assembly_1__model_1

2a8e__assembly_1__model_1 | I(q)

2a8e__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (1)

Three-dimensional structure of Bacillus subtilis Q45498 putative protein at resolution 2.5A. Northeast Structural Genomics Consortium target SR204.

1. Protein Identity and Related Structures Protein Identity & Related Structures

hypothetical protein yktB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2a8e__assembly_1__model_1

2a8e__assembly_1__model_1 | I(q)

2a8e__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (1)