SAXSdb — 2aam

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein TM1410

Thermotoga maritima

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	UNKNOWN LIGAND × 1 GLYCEROL × 7 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	UNKNOWN LIGAND × 1 GLYCEROL × 10 water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	UNKNOWN LIGAND × 1 GLYCEROL × 4 water × 1	Consistent with protein count
4	Protein monomer	Monomer	Protein 1	UNKNOWN LIGAND × 1 GLYCEROL × 5 water × 1	Consistent with protein count
5	Protein monomer	Monomer	Protein 1	UNKNOWN LIGAND × 1 GLYCEROL × 4 water × 1	Consistent with protein count
6	Protein monomer	Monomer	Protein 1	UNKNOWN LIGAND × 1 GLYCEROL × 7 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Y1410_THEMA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 13–309； UniProt 27–323 Author chain B； PDBConstruct 13–309； UniProt 27–323 Author chain C； PDBConstruct 13–309； UniProt 27–323 Author chain D； PDBConstruct 13–309； UniProt 27–323 Author chain E； PDBConstruct 13–309； UniProt 27–323 Author chain F； PDBConstruct 13–309； UniProt 27–323

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2aam
Deposition date deposition_date	2005-07-13
Structure title title	Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution
Keywords keywords	Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, hydrolase; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2aam__assembly_4__model_1

Assembly 4 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2aam__assembly_4__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2aam__assembly_4__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.63 Å
Rg (electron density)	18.40 Å
Total Rg	19.29 Å
Atom count	2407
Residues	281
Excluded volume	42543 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2aam__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2aam__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2aam__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2aam__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`2aam__assembly_5__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`2aam__assembly_6__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Hypothetical protein TM1410
Molecular weight formula_weight	36579.7 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	15499

MGSDKIHHHHHHTEGWFMPFDNWLYQLQNADPVEISSSGFEIAVIDYSKDGSESGEYSPEEIKIMVDAGVVPVAYVNIGQAEDYRFYWKESWYTNTPEWLGEEDPAWPGNYFVKYWYNEWKEIVFSYLDRVIDQGFKGIYLDRIDSFEYWAQEGVISRRSAARKMINFVLEIAEYVRERKPDMLIIPQNGENILDFDDGQLASTVSGWAVENLFYLKTIPLEENETKSRLEYLIRLNRKGKFILSVDYVDDGSDSFENISRILDYYEKAKRNGCIPYAARSDLELDEMNVIEGIQPPEALKDYESRTYR

Source Source

Source organism organism	Thermotoga maritima
NCBI taxonomy ID ncbi_taxonomy_id	2336
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	UNKNOWN LIGAND
Source method src_method	syn
Copy count entity_count	6

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	37

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	926

▼

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d2aama1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.1 — TIM beta/alpha-barrel
Superfamily Superfamily superfamily	c.1.8 — (Trans)glycosidases
Family Family family	c.1.8.15 — TM1410-like

Domain ID domain_id	d2aamb_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.1 — TIM beta/alpha-barrel
Superfamily Superfamily superfamily	c.1.8 — (Trans)glycosidases
Family Family family	c.1.8.15 — TM1410-like

Domain ID domain_id	d2aamc_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.1 — TIM beta/alpha-barrel
Superfamily Superfamily superfamily	c.1.8 — (Trans)glycosidases
Family Family family	c.1.8.15 — TM1410-like

Domain ID domain_id	d2aamd_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.1 — TIM beta/alpha-barrel
Superfamily Superfamily superfamily	c.1.8 — (Trans)glycosidases
Family Family family	c.1.8.15 — TM1410-like

Domain ID domain_id	d2aame_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.1 — TIM beta/alpha-barrel
Superfamily Superfamily superfamily	c.1.8 — (Trans)glycosidases
Family Family family	c.1.8.15 — TM1410-like

Domain ID domain_id	d2aamf_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.1 — TIM beta/alpha-barrel
Superfamily Superfamily superfamily	c.1.8 — (Trans)glycosidases
Family Family family	c.1.8.15 — TM1410-like

CATH v4.4 (6 domains)

Domain ID domain_id	2aamA00
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	20 — TIM Barrel
Homologous superfamily homologous superfamily	70 — Aldolase class I

Domain ID domain_id	2aamB00
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	20 — TIM Barrel
Homologous superfamily homologous superfamily	70 — Aldolase class I

Domain ID domain_id	2aamC00
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	20 — TIM Barrel
Homologous superfamily homologous superfamily	70 — Aldolase class I

Domain ID domain_id	2aamD00
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	20 — TIM Barrel
Homologous superfamily homologous superfamily	70 — Aldolase class I

Domain ID domain_id	2aamE00
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	20 — TIM Barrel
Homologous superfamily homologous superfamily	70 — Aldolase class I

Domain ID domain_id	2aamF00
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	20 — TIM Barrel
Homologous superfamily homologous superfamily	70 — Aldolase class I

▶

Unit-cell length a length_a	194.930 Å
Unit-cell length b length_b	84.620 Å
Unit-cell length c length_c	195.010 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	119.90 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.200 Å
Low-resolution limit resolution_low	28.590 Å
R factor r_factor	—
R_work r_work	0.2160
R_free r_free	0.2390

Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein TM1410

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2aam__assembly_4__model_1

2aam__assembly_4__model_1 | I(q)

2aam__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

CATH v4.4 (6 domains)

7. Citations (1)

Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein TM1410

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2aam__assembly_4__model_1

2aam__assembly_4__model_1 | I(q)

2aam__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

CATH v4.4 (6 domains)

7. Citations (1)