SAXSdb — 2aj7

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

hypothetical protein BH3618

Bacillus halodurans

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	1,2-ETHANEDIOL × 12 FORMIC ACID × 7 NICKEL (II) ION × 1 POTASSIUM ION × 1 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 6	1,2-ETHANEDIOL × 36 FORMIC ACID × 21 NICKEL (II) ION × 3 POTASSIUM ION × 3 water × 6	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 6	1,2-ETHANEDIOL × 36 FORMIC ACID × 21 NICKEL (II) ION × 3 POTASSIUM ION × 3 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9K6V7_BACHD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 13–163； UniProt 1–151 Author chain B； PDBConstruct 13–163； UniProt 1–151

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2aj7
Deposition date deposition_date	2005-08-01
Structure title title	Crystal structure of a putative contractile protein (bh3618) from bacillus halodurans at 1.67 A resolution
Keywords keywords	;Bh3618-like fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, contractile protein ;; CONTRACTILE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2aj7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2aj7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2aj7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.75 Å
Rg (electron density)	21.36 Å
Total Rg	22.44 Å
Atom count	2483
Residues	302
Excluded volume	45041 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2aj7__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2aj7__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2aj7__assembly_3__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	hypothetical protein BH3618
Molecular weight formula_weight	18608.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2985

MGSDKIHHHHHHMKVIETKYSGKLEVAEDRLIAFDQGIPAFEDEKEFVLLPFAAGTPYYTLQSTKTVDLAFIIVNPFSFFPEYRVKLPEATIAQLNITNENDVAIFSLLTVKEPFSETTVNLQAPIVINANKQMGKQLVLGDTAYNRKQPLFQKELVLAKEAK

Source Source

Source organism organism	Bacillus halodurans
NCBI taxonomy ID ncbi_taxonomy_id	86665
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 3 Entity 3 non-polymer

Description description	FORMIC ACID
Molecular weight formula_weight	46.0 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 4 Entity 4 non-polymer

Description description	NICKEL (II) ION
Molecular weight formula_weight	58.7 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	401

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2aj7a1
Class class	b — All beta proteins
Fold Fold fold	b.158 — BH3618-like
Superfamily Superfamily superfamily	b.158.1 — BH3618-like
Family Family family	b.158.1.1 — BH3618-like

Domain ID domain_id	d2aj7a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2aj7b2
Class class	b — All beta proteins
Fold Fold fold	b.158 — BH3618-like
Superfamily Superfamily superfamily	b.158.1 — BH3618-like
Family Family family	b.158.1.1 — BH3618-like

Domain ID domain_id	d2aj7b3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (2 domains)

Domain ID domain_id	2aj7A00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	290 — BH3618-like
Homologous superfamily homologous superfamily	10 — BH3618-like

Domain ID domain_id	2aj7B00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	290 — BH3618-like
Homologous superfamily homologous superfamily	10 — BH3618-like

▶

Unit-cell length a length_a	108.810 Å
Unit-cell length b length_b	108.810 Å
Unit-cell length c length_c	82.180 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 63
Space-group number int_tables_number	173
Crystal system crystal_system	—

Resolution resolution	1.670 Å
Low-resolution limit resolution_low	47.120 Å
R factor r_factor	—
R_work r_work	0.1670
R_free r_free	0.1910

Crystal structure of a putative contractile protein (bh3618) from bacillus halodurans at 1.67 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

hypothetical protein BH3618

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2aj7__assembly_1__model_1

2aj7__assembly_1__model_1 | I(q)

2aj7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Crystal structure of a putative contractile protein (bh3618) from bacillus halodurans at 1.67 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

hypothetical protein BH3618

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2aj7__assembly_1__model_1

2aj7__assembly_1__model_1 | I(q)

2aj7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (1)