SAXSdb — 2az0

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

B2 protein

Flock house virus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Homooligomer	Protein 2 RNA 2	5'-R(GPCPAP(5BU)PGPGPAPCPGPCPGP(5BU)PCPCPAP(5BU)PGPC)-3' × 2 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B2_FHV
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–73； UniProt 1–73 Author chain B； PDBConstruct 1–73； UniProt 1–73

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2az0
Deposition date deposition_date	2005-09-09
Structure title title	Flock House virus B2-dsRNA Complex (P212121)
Keywords keywords	protein-rna complex, four-helix bundle, Viral protein-RNA COMPLEX; Viral protein/RNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2az0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2az0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2az0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.80 Å
Rg (electron density)	19.34 Å
Total Rg	19.91 Å
Atom count	1849
Residues	171
Excluded volume	30349 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2az0__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	5'-R(GPCPAP(5BU)PGPGPAPCPGPCPGP(5BU)PCPCPAP(5BU)PGPC)-3'
Molecular weight formula_weight	6000.2 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	C,D
Atom count atom_count	1872

GCAUGGACGCGUCCAUGC

Entity 2 Entity 2 polymer

Description description	B2 protein
Molecular weight formula_weight	8036.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B

MPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVSRMVTSLLEKPSVVAYLEGKA

Source Source

Source organism organism	Flock house virus
NCBI taxonomy ID ncbi_taxonomy_id	12287
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	23

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d2az0a1
Class class	a — All alpha proteins
Fold Fold fold	a.30 — ROP-like
Superfamily Superfamily superfamily	a.30.8 — FHV B2 protein-like
Family Family family	a.30.8.1 — FHV B2 protein-like

Domain ID domain_id	d2az0b_
Class class	a — All alpha proteins
Fold Fold fold	a.30 — ROP-like
Superfamily Superfamily superfamily	a.30.8 — FHV B2 protein-like
Family Family family	a.30.8.1 — FHV B2 protein-like

CATH v4.4 (2 domains)

Domain ID domain_id	2az0A00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	1060 — ESAT-6-like

Domain ID domain_id	2az0B00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	1060 — ESAT-6-like

▶

Unit-cell length a length_a	50.261 Å
Unit-cell length b length_b	86.232 Å
Unit-cell length c length_c	94.338 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.600 Å
Low-resolution limit resolution_low	34.400 Å
R factor r_factor	0.2420
R_work r_work	0.2410
R_free r_free	0.2690

Flock House virus B2-dsRNA Complex (P212121)

1. Protein Identity and Related Structures Protein Identity & Related Structures

B2 protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2az0__assembly_1__model_1

2az0__assembly_1__model_1 | I(q)

2az0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Flock House virus B2-dsRNA Complex (P212121)

1. Protein Identity and Related Structures Protein Identity & Related Structures

B2 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2az0__assembly_1__model_1

2az0__assembly_1__model_1 | I(q)

2az0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)