SAXSdb — 2b26

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

SIS1 protein

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 181–352 Chain B； UniProt 181–352	Fragment：Yeast Hsp40 Sis1 C-terminal domain	Heat shock 70 kDa protein cognate 2 × 1 （P11146）	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 3.20 Å R-free 0.339
2	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 181–352	Fragment：Yeast Hsp40 Sis1 C-terminal domain	No other associated polymer	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 3.20 Å R-free 0.339

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2B26	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1C3G S. CEREVISIAE HEAT SHOCK PROTEIN 40 SIS1 Deposited 1999-07-27	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 180–349（170 aa） Fragment：SIS1 C-TERMINAL PEPTIDE-BINDING DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；298 K；PEG 3350 20%, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 25K	Resolution 2.70 Å R-free 0.311
4RWU J-domain of Sis1 protein, Hsp40 co-chaperone from Saccharomyces cerevisiae Deposited 2014-12-05	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–89（89 aa） Fragment：J-domain (UNP residues 1-89)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；289 K；2.4 M sodium malonate, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 289K	Resolution 1.25 Å R-free 0.149
8EOD EEVD:Sis1-81 (J domain) bound conformation Deposited 2022-10-03	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–81（80 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.2；298 K；Ionic strength (raw mmCIF value) 0.2；Pressure 1 NMR sample composition 500 uM [U-13C; U-15N] 15N-13C-Sis11-81:EEVD, 1 mM [U-90% 15N] 15N-Sis11-81:EEVD, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SIS1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–173； UniProt 181–352 Author chain B； PDBConstruct 2–173； UniProt 181–352 Author chain C； PDBConstruct 2–173； UniProt 181–352

Heat shock 70 kDa protein cognate 2

Drosophila melanogaster

UniProt P11146

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain D； UniProt 626–632	Fragment：yeast Hsp70 Ssa1 C-terminal domain	SIS1 protein × 2 （P25294）	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 3.20 Å R-free 0.339

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	HSP7B_DROME
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–7； UniProt 626–632

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2b26
Deposition date deposition_date	2005-09-16
Structure title title	The crystal structure of the protein complex of yeast Hsp40 Sis1 and Hsp70 Ssa1
Keywords keywords	Hsp40 Sis1 Hsp70 Ssa1, CHAPERONE-PROTEIN TRANSPORT COMPLEX; CHAPERONE/PROTEIN TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	37.61 Å
Radius of gyration Rg (electron density) rg_electron	38.06 Å
Forward intensity I(0) i0	35493800.00
Molecular weight molecular_weight	48557.0 kDa
Excluded volume excluded_volume	61664 Å³
Envelope volume envelope_volume	101210 Å³
Hydration-shell volume shell_volume	25014 Å³
Envelope diameter envelope_diameter	140.5 Å
Shell Rg shell_rg	38.68 Å
Envelope Rg envelope_rg	37.46 Å
Shape Rg shape_rg	38.04 Å
Total Rg total_rg	38.16 Å
Total atoms total_atoms	3428
Residues n_residues	433
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	133.6 Å
Rg (real space) rg_real	38.00 Å
Rg uncertainty (real space) rg_real_error	1.90 Å
I(0) (real space) i0_real	3.5490e+07
I(0) uncertainty (real space) i0_real_error	7.3440e+05
Rg (reciprocal space) rg_reciprocal	37.76 Å
I(0) (reciprocal space) i0_reciprocal	35490000.0000
Solution quality estimate total_estimate	0.7605
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	47.7 Å
Skewness Skewness skewness	0.445
Kurtosis Kurtosis kurtosis	-0.259
Angular range angular_range	— – 0.2100 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	1348000.0000
Real-space data points n_real_points	43
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.385; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.801; Smooth: 0.927

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	SIS1 protein
Molecular weight formula_weight	19488.2 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	3428

ETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAIDENF

来源 Source

来源生物 organism	Saccharomyces cerevisiae
通用名 common_name	;baker's yeast ;
NCBI Class编号 ncbi_taxonomy_id	4932
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Heat shock 70 kDa protein cognate 2
Molecular weight formula_weight	787.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

PTVEEVD

来源 Source

来源生物 organism	Drosophila melanogaster
通用名 common_name	fruit fly
NCBI Class编号 ncbi_taxonomy_id	7227
宿主生物 host_organism	Escherichia coli

▼

7. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d2b26a1
Class class	b — All beta proteins
Fold Fold fold	b.4 — HSP40/DnaJ peptide-binding domain
Superfamily Superfamily superfamily	b.4.1 — HSP40/DnaJ peptide-binding domain
Family Family family	b.4.1.1 — HSP40/DnaJ peptide-binding domain

Domain ID domain_id	d2b26a2
Class class	b — All beta proteins
Fold Fold fold	b.4 — HSP40/DnaJ peptide-binding domain
Superfamily Superfamily superfamily	b.4.1 — HSP40/DnaJ peptide-binding domain
Family Family family	b.4.1.1 — HSP40/DnaJ peptide-binding domain

Domain ID domain_id	d2b26a3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2b26b1
Class class	b — All beta proteins
Fold Fold fold	b.4 — HSP40/DnaJ peptide-binding domain
Superfamily Superfamily superfamily	b.4.1 — HSP40/DnaJ peptide-binding domain
Family Family family	b.4.1.1 — HSP40/DnaJ peptide-binding domain

Domain ID domain_id	d2b26b2
Class class	b — All beta proteins
Fold Fold fold	b.4 — HSP40/DnaJ peptide-binding domain
Superfamily Superfamily superfamily	b.4.1 — HSP40/DnaJ peptide-binding domain
Family Family family	b.4.1.1 — HSP40/DnaJ peptide-binding domain

Domain ID domain_id	d2b26b3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (6 domains)

Domain ID domain_id	2b26A01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	260 — HSP40/DNAj peptide-binding domain
Homologous superfamily homologous superfamily	20 — Urease metallochaperone UreE, N-terminal domain

Domain ID domain_id	2b26A02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	260 — HSP40/DNAj peptide-binding domain
Homologous superfamily homologous superfamily	20 — Urease metallochaperone UreE, N-terminal domain

Domain ID domain_id	2b26B01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	260 — HSP40/DNAj peptide-binding domain
Homologous superfamily homologous superfamily	20 — Urease metallochaperone UreE, N-terminal domain

Domain ID domain_id	2b26B02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	260 — HSP40/DNAj peptide-binding domain
Homologous superfamily homologous superfamily	20 — Urease metallochaperone UreE, N-terminal domain

Domain ID domain_id	2b26C01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	260 — HSP40/DNAj peptide-binding domain
Homologous superfamily homologous superfamily	20 — Urease metallochaperone UreE, N-terminal domain

Domain ID domain_id	2b26C02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	260 — HSP40/DNAj peptide-binding domain
Homologous superfamily homologous superfamily	20 — Urease metallochaperone UreE, N-terminal domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	113.867 Å
Unit-cell length b length_b	113.867 Å
Unit-cell length c length_c	173.881 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	3.200 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2760
R_work r_work	0.2760
R_free r_free	0.3390

fit	/app/data/saxs_computation/b2/2b26/2b26.fit
pddf	/app/data/pr_computation/b2/2b26/2b26.pr.out
profile	/app/data/saxs_computation/b2/2b26/2b26.dat

The crystal structure of the protein complex of yeast Hsp40 Sis1 and Hsp70 Ssa1

1. Protein Identity and Related Structures Protein Identity & Related Structures

SIS1 protein

State in the Current Structure

Other States of the Same Protein in the Database

Heat shock 70 kDa protein cognate 2

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

7. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

CATH v4.4 (6 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)