SAXSdb — 2c0g

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

WINDBEUTEL PROTEIN

DROSOPHILA MELANOGASTER

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	SODIUM ION × 1 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	CHLORIDE ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	WBL_DROME
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 13–248； UniProt 22–257 Author chain B； PDBConstruct 13–248； UniProt 22–257

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2c0g
Deposition date deposition_date	2005-09-02
Structure title title	Structure of PDI-related Chaperone, Wind mutant-Y53S
Keywords keywords	;WIND, WINDBEUTEL, PDI-DBETA, PDI, PROTEIN DISULFIDE ISOMERASE, PIPE, DORSAL-VENTRAL PATTERNING, CHAPERONE, WIND MUTANTS, DEVELOPMENTAL PROTEIN, ENDOPLASMIC RETICULUM ;; CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2c0g__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2c0g__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2c0g__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.54 Å
Rg (electron density)	20.68 Å
Total Rg	21.36 Å
Atom count	1532
Residues	221
Excluded volume	26876 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2c0g__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2c0g__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	WINDBEUTEL PROTEIN
Molecular weight formula_weight	28471.4 kDa
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3473

MRGSHHHHHHGSVTCTGCVDLDELSFEKTVERFPYSVVKFDIASPYGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQQNARAYLIYMRKIHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEVFRVHKVTKTAPEKEEL

Source Source

Source organism organism	DROSOPHILA MELANOGASTER
Common name common_name	FRUIT FLY
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	167

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2c0ga1
Class class	a — All alpha proteins
Fold Fold fold	a.71 — ERP29 C domain-like
Superfamily Superfamily superfamily	a.71.1 — ERP29 C domain-like
Family Family family	a.71.1.0 — automated matches

Domain ID domain_id	d2c0ga2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.47 — Thioredoxin fold
Superfamily Superfamily superfamily	c.47.1 — Thioredoxin-like
Family Family family	c.47.1.7 — ERP29 N domain-like

Domain ID domain_id	d2c0gb1
Class class	a — All alpha proteins
Fold Fold fold	a.71 — ERP29 C domain-like
Superfamily Superfamily superfamily	a.71.1 — ERP29 C domain-like
Family Family family	a.71.1.0 — automated matches

Domain ID domain_id	d2c0gb2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.47 — Thioredoxin fold
Superfamily Superfamily superfamily	c.47.1 — Thioredoxin-like
Family Family family	c.47.1.7 — ERP29 N domain-like

CATH v4.4 (4 domains)

Domain ID domain_id	2c0gA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	30 — Glutaredoxin
Homologous superfamily homologous superfamily	10 — Glutaredoxin

Domain ID domain_id	2c0gA02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1150 — Endoplasmic reticulum protein erp29
Homologous superfamily homologous superfamily	12 — Endoplasmic reticulum resident protein 29, C-terminal domain

Domain ID domain_id	2c0gB01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	30 — Glutaredoxin
Homologous superfamily homologous superfamily	10 — Glutaredoxin

Domain ID domain_id	2c0gB02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1150 — Endoplasmic reticulum protein erp29
Homologous superfamily homologous superfamily	12 — Endoplasmic reticulum resident protein 29, C-terminal domain

▶

Unit-cell length a length_a	108.476 Å
Unit-cell length b length_b	50.557 Å
Unit-cell length c length_c	98.900 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	112.06 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	1.750 Å
Low-resolution limit resolution_low	25.000 Å
R factor r_factor	0.2220
R_work r_work	0.2190
R_free r_free	0.2680

Structure of PDI-related Chaperone, Wind mutant-Y53S

1. Protein Identity and Related Structures Protein Identity & Related Structures

WINDBEUTEL PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2c0g__assembly_2__model_1

2c0g__assembly_2__model_1 | I(q)

2c0g__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (3)

Structure of PDI-related Chaperone, Wind mutant-Y53S

1. Protein Identity and Related Structures Protein Identity & Related Structures

WINDBEUTEL PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2c0g__assembly_2__model_1

2c0g__assembly_2__model_1 | I(q)

2c0g__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (3)