SAXSdb — 2cf2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

No usable UniProt protein identity is available for this entry.

The relationship tables retain this entry's assembly and composition data, but cross-PDB links for the same protein cannot be established reliably without a unified protein identity.

Assembly Composition of the Current Entry

Assembly	Physical composition	Protein state	蛋白 / DNA / RNA / 其他Polymer	Data consistency
1	Protein heterocomplex	Heteromer	10 / 0 / 0 / 0	Consistent with protein count

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2cf2
Deposition date deposition_date	2006-02-14
Structure title title	Architecture of mammalian fatty acid synthase
Keywords keywords	TRANSFERASE, FATTY ACID METABOLISM, FATTY ACID BIOSYNTHESIS, MULTIENZYME; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2cf2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2cf2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2cf2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	56.95 Å
Rg (electron density)	57.08 Å
Total Rg	56.98 Å
Atom count	0
Residues	0
Excluded volume	411390 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2cf2__assembly_1__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	FATTY ACID SYNTHASE, KS DOMAIN
Molecular weight formula_weight	42668.2 kDa
EC 编号 ec_number	2.3.1.85
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,J
Atom count atom_count	3146

MKRVVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSASATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKLKD

Entity 2 Entity 2 polymer

Description description	FATTY ACID SYNTHASE, MAT DOMAIN
Molecular weight formula_weight	30981.4 kDa
EC 编号 ec_number	2.3.1.85
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,K

MLVLVAPGQGAQTPGFLTDWLALPGAADRVAAWSDAIGLDLAHFGTKADADEIRDTSVAQPLLVAAGILSAAALGTGFTPGAVAGHSVGEITAAVFAGVLDDTAALSLVRRRGLAMAEAAAVTETGMSALLGGDPEVSVAHLERLGLTPANVNGAGQIVAAGTMEQLAALNEDKPEGVRKVVPLKVAGAFHTRHMAPAVDKLAEAAKALTPADPKVTYVSNKDGRAVASGTEVLDRLVGQVANPVRWDLCMETFKELGVTAIIEVCPGGTLTGLAKRALPGVKTLALKTPDDLDAARELVAEHT

Entity 3 Entity 3 polymer

Description description	FATTY ACID SYNTHASE, DH DOMAIN
Molecular weight formula_weight	37701.6 kDa
EC 编号 ec_number	2.3.1.85
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,L

VDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDINPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTAKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKVGLFQDTSAFVDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDINPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTAKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKVGLFQDTSAF

Entity 4 Entity 4 polymer

Description description	FATTY ACID SYNTHASE, ER DOMAIN
Molecular weight formula_weight	31513.0 kDa
EC 编号 ec_number	2.3.1.85
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,M

MKAWVLKRLGGPLELVDLPEPEAEEGEVVLRVEAVGLNFADHLMRLGAYLTRLHPPFIPGMEVVGVVEGRRYAALVPQGGLAERVAVPKGALLPLPEGLSPEEAAAFPVSFLTAYLALKRAQARPGEKVLVQAAAGALGTAAVQVARAMGLRVLAAASRPEKLALPLALGAEEAATYAEVPERAKAWGGLDLVLEVRGKEVEESLGLLAHGGRLVYIAPIPPLRLMRRNLAVLGFWLTPLLREGALVEEALGFLLPRLGRELRPVVGPVFPFAEAEAAFRALLDRGHTGKVVVRL

Entity 5 Entity 5 polymer

Description description	FATTY ACID SYNTHASE, KR DOMAIN
Molecular weight formula_weight	23702.1 kDa
EC 编号 ec_number	2.3.1.85
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,N

MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYLGANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGM

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (8 domains)

Domain ID domain_id	d2cf2a1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.95 — Thiolase-like
Superfamily Superfamily superfamily	c.95.1 — Thiolase-like
Family Family family	c.95.1.1 — Thiolase-related

Domain ID domain_id	d2cf2a2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.95 — Thiolase-like
Superfamily Superfamily superfamily	c.95.1 — Thiolase-like
Family Family family	c.95.1.1 — Thiolase-related

Domain ID domain_id	d2cf2c1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.38 — Thioesterase/thiol ester dehydrase-isomerase
Superfamily Superfamily superfamily	d.38.1 — Thioesterase/thiol ester dehydrase-isomerase
Family Family family	d.38.1.2 — beta-Hydroxydecanol thiol ester dehydrase

Domain ID domain_id	d2cf2e1
Class class	i — Low resolution protein structures
Fold Fold fold	i.26 — Fatty acid synthase
Superfamily Superfamily superfamily	i.26.1 — Fatty acid synthase
Family Family family	i.26.1.1 — Fatty acid syntase

Domain ID domain_id	d2cf2j1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.95 — Thiolase-like
Superfamily Superfamily superfamily	c.95.1 — Thiolase-like
Family Family family	c.95.1.1 — Thiolase-related

Domain ID domain_id	d2cf2j2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.95 — Thiolase-like
Superfamily Superfamily superfamily	c.95.1 — Thiolase-like
Family Family family	c.95.1.1 — Thiolase-related

Domain ID domain_id	d2cf2l1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.38 — Thioesterase/thiol ester dehydrase-isomerase
Superfamily Superfamily superfamily	d.38.1 — Thioesterase/thiol ester dehydrase-isomerase
Family Family family	d.38.1.2 — beta-Hydroxydecanol thiol ester dehydrase

Domain ID domain_id	d2cf2n1
Class class	i — Low resolution protein structures
Fold Fold fold	i.26 — Fatty acid synthase
Superfamily Superfamily superfamily	i.26.1 — Fatty acid synthase
Family Family family	i.26.1.1 — Fatty acid syntase

▶

Unit-cell length a length_a	96.100 Å
Unit-cell length b length_b	245.000 Å
Unit-cell length c length_c	134.100 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	101.20 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	4.300 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Architecture of mammalian fatty acid synthase

1. Protein Identity and Related Structures Protein Identity & Related Structures

Assembly Composition of the Current Entry

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2cf2__assembly_1__model_1

2cf2__assembly_1__model_1 | I(q)

2cf2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (8 domains)

7. Citations (1)