SAXSdb — 2dsy

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein TTHA0281

Thermus thermophilus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	MAGNESIUM ION × 1 2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5SLL2_THET8
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–87； UniProt 1–87 Author chain B； PDBConstruct 1–87； UniProt 1–87 Author chain C； PDBConstruct 1–87； UniProt 1–87 Author chain D； PDBConstruct 1–87； UniProt 1–87

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2dsy
Deposition date deposition_date	2006-07-07
Structure title title	Crystal structure of TTHA0281 from thermus thermophilus HB8
Keywords keywords	;STRUCTURAL GENOMICS, THERMUS THERMOPHILUS HB8, HYPOTHETICAL PROTEIN, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ;; STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2dsy__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2dsy__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2dsy__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.24 Å
Rg (electron density)	21.49 Å
Total Rg	21.96 Å
Atom count	2509
Residues	306
Excluded volume	45015 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2dsy__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Hypothetical protein TTHA0281
Molecular weight formula_weight	9825.6 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	2691

MDGMGTLTRYLEEAMARARYELIADEEPYYGEIPDLPGVWATGKSLKECEANLQAALEDWLLFLLSRGETPPPLGEVRIELPHGEAA

Source Source

Source organism organism	Thermus thermophilus
NCBI taxonomy ID ncbi_taxonomy_id	274
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID
Molecular weight formula_weight	207.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	174

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2dsya1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.304 — TTHA1013/TTHA0281-like
Superfamily Superfamily superfamily	d.304.1 — TTHA1013/TTHA0281-like
Family Family family	d.304.1.2 — TTHA0281-like

Domain ID domain_id	d2dsyb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.304 — TTHA1013/TTHA0281-like
Superfamily Superfamily superfamily	d.304.1 — TTHA1013/TTHA0281-like
Family Family family	d.304.1.2 — TTHA0281-like

Domain ID domain_id	d2dsyc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.304 — TTHA1013/TTHA0281-like
Superfamily Superfamily superfamily	d.304.1 — TTHA1013/TTHA0281-like
Family Family family	d.304.1.2 — TTHA0281-like

Domain ID domain_id	d2dsyd_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.304 — TTHA1013/TTHA0281-like
Superfamily Superfamily superfamily	d.304.1 — TTHA1013/TTHA0281-like
Family Family family	d.304.1.2 — TTHA0281-like

CATH v4.4 (4 domains)

Domain ID domain_id	2dsyA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	160 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	250 —

Domain ID domain_id	2dsyB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	160 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	250 —

Domain ID domain_id	2dsyC00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	160 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	250 —

Domain ID domain_id	2dsyD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	160 — Double Stranded RNA Binding Domain
Homologous superfamily homologous superfamily	250 —

▶

Unit-cell length a length_a	38.996 Å
Unit-cell length b length_b	62.743 Å
Unit-cell length c length_c	65.724 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	104.31 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.1850
R_work r_work	0.1830
R_free r_free	0.2320

Crystal structure of TTHA0281 from thermus thermophilus HB8

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein TTHA0281

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2dsy__assembly_1__model_1

2dsy__assembly_1__model_1 | I(q)

2dsy__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of TTHA0281 from thermus thermophilus HB8

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein TTHA0281

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2dsy__assembly_1__model_1

2dsy__assembly_1__model_1 | I(q)

2dsy__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)