SAXSdb — 2ec6

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Myosin heavy chain

Placopecten magellanicus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Myosin regulatory light chain × 1 （Q26069） Myosin essential light chain × 1 （Q26066） CALCIUM ION × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q26079_PLAMG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–838； UniProt 1–838

Myosin regulatory light chain

Placopecten magellanicus

UniProt Q26069

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Myosin heavy chain × 1 （Q26079） Myosin essential light chain × 1 （Q26066） CALCIUM ION × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q26069_PLAMG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–133； UniProt 23–155

Myosin essential light chain

Placopecten magellanicus

UniProt Q26066

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Myosin heavy chain × 1 （Q26079） Myosin regulatory light chain × 1 （Q26069） CALCIUM ION × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q26066_PLAMG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–156； UniProt 2–157

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2ec6
Deposition date deposition_date	2007-02-10
Structure title title	Placopecten Striated Muscle Myosin II
Keywords keywords	muscle, rigor-like, actin binding, CONTRACTILE PROTEIN; CONTRACTILE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2ec6__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2ec6__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2ec6__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	46.33 Å
Rg (electron density)	48.25 Å
Total Rg	48.14 Å
Atom count	8546
Residues	1083
Excluded volume	151990 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2ec6__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Myosin heavy chain
Molecular weight formula_weight	95832.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	8577

MNIDFNDPDFQYLAVDRKKMMKEQTAPFDGKKNCWVPDPKEGFASAEIQSSKGEEITVKIVSDNSTRTVKKDDIQQMNPPKFEKLEDMANMTYLNEASVLNNLRGRYTAGLIYTYSGLFCIAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAYQNMVTDRENQSCLITGESGAGKTENTKKVIMYLAKVACAVKKKTSEEEEADQKKGSLEDQIIQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNAIPELNEVMLITPDSGLYSFINQGCLTVDNIDDVEEFKLCDEAFDILGFTKEEKTSMFKCTASILHMGEMKFKQRPREEQAESDGTAEAEKVAFLCGINAGDLLKALLKPKVKVGTEMVTKGQNLQQVINSVGALSKSLYDRMFNWLVKRVNRTLDTKAKRNYYIGVLDIAGFEIFDFNSFEQLCINYTNERLQQFFNHHMFVLEQEEYKKEGIQWEFIDFGMDLQMCIDLIEKPMGILSILEEECMFPKADDKSFQDYSYQNHIGKNRMFTKPGKPTRPNQGHAHFELHHYAGNVPYSIAGWLDKNKDPINENVVSLLAVSKEPLVAELFRAPDEPAGGAGGKKKKKSSAFQTISAVHRESLNKLMKNLYSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGIRICRKGFPSRLIYSEFKQRYSILAPNAIPQGFVDGKTVSEKILTGLQMDPSEYRLGTTKVFFKAGVLGNLEEMRDERLSKIISMFQAHIRGYLIRKAYKKLQDQRIGLSVIQRNIRKWLVLRNWQWWKLYAKVKP

Source Source

Source organism organism	Placopecten magellanicus
Common name common_name	sea scallop
NCBI taxonomy ID ncbi_taxonomy_id	6577

Entity 2 Entity 2 polymer

Description description	Myosin regulatory light chain
Molecular weight formula_weight	15354.4 kDa
Mutation mutation	Y84F, T151A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MQEMKEAFTMIDQNRDGFIDINDLKEEFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDEDATKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIK

Source Source

Source organism organism	Placopecten magellanicus
Common name common_name	sea scallop
NCBI taxonomy ID ncbi_taxonomy_id	6577

Entity 3 Entity 3 polymer

Description description	Myosin essential light chain
Molecular weight formula_weight	17620.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLSGLGERLSDEEVDEIINLTDLQEDLEGNVKYEEFVKKVMAGPYPDK

Source Source

Source organism organism	Placopecten magellanicus
Common name common_name	sea scallop
NCBI taxonomy ID ncbi_taxonomy_id	6577

Entity 4 Entity 4 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	31

▼

6. Fold Classification (SCOP + CATH) 7 domains

CATH v4.4 (7 domains)

Domain ID domain_id	2ec6A01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	720 — Myosin VI head, motor domain, U50 subdomain

Domain ID domain_id	2ec6A02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	530 —

Domain ID domain_id	2ec6A03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1590 —

Domain ID domain_id	2ec6B01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	2ec6B02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	2ec6C01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	2ec6C02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

▶

Unit-cell length a length_a	85.273 Å
Unit-cell length b length_b	50.366 Å
Unit-cell length c length_c	156.774 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	101.04 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.250 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2790
R_work r_work	0.2790
R_free r_free	0.3000

Placopecten Striated Muscle Myosin II

1. Protein Identity and Related Structures Protein Identity & Related Structures

Myosin heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

Myosin regulatory light chain

State in the Current Structure

Other States of the Same Protein in the Database

Myosin essential light chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2ec6__assembly_1__model_1

2ec6__assembly_1__model_1 | I(q)

2ec6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 7 domains

CATH v4.4 (7 domains)

7. Citations (1)

Placopecten Striated Muscle Myosin II

1. Protein Identity and Related Structures Protein Identity & Related Structures

Myosin heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Myosin regulatory light chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Myosin essential light chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2ec6__assembly_1__model_1

2ec6__assembly_1__model_1 | I(q)

2ec6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 7 domains

CATH v4.4 (7 domains)

7. Citations (1)