SAXSdb — 2ejn

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major allergen I polypeptide chain 1, chain 2

Felis catus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	CALCIUM ION × 4 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FEL1A_FELCA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–71； UniProt 23–92 Author chain B； PDBConstruct 2–71； UniProt 23–92

Major allergen I polypeptide chain 1, chain 2

Felis catus

UniProt P30440

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	CALCIUM ION × 4 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FEL1B_FELCA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 72–147； UniProt 18–93 Author chain B； PDBConstruct 72–147； UniProt 18–93

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2ejn
Deposition date deposition_date	2007-03-19
Structure title title	Structural characterization of the tetrameric form of the major cat allergen fel D 1
Keywords keywords	ALLERGEN, CAT ALLERGEN, UTEROGLOBIN, SECRETOGLOBIN; ALLERGEN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2ejn__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2ejn__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2ejn__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.73 Å
Rg (electron density)	18.53 Å
Total Rg	19.53 Å
Atom count	2258
Residues	291
Excluded volume	40958 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2ejn__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Major allergen I polypeptide chain 1, chain 2
Molecular weight formula_weight	17208.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2533

MEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSLLDKIYTSPLCVKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMKKIQDCYVENGLISRVLDGLVMTTISSSKDCMGEHHHHHH

Source Source

Source organism organism	Felis catus
Common name common_name	domestic cat
NCBI taxonomy ID ncbi_taxonomy_id	9685
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	270

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2ejna1
Class class	a — All alpha proteins
Fold Fold fold	a.101 — Uteroglobin-like
Superfamily Superfamily superfamily	a.101.1 — Uteroglobin-like
Family Family family	a.101.1.1 — Uteroglobin-like

Domain ID domain_id	d2ejna2
Class class	a — All alpha proteins
Fold Fold fold	a.101 — Uteroglobin-like
Superfamily Superfamily superfamily	a.101.1 — Uteroglobin-like
Family Family family	a.101.1.1 — Uteroglobin-like

Domain ID domain_id	d2ejnb1
Class class	a — All alpha proteins
Fold Fold fold	a.101 — Uteroglobin-like
Superfamily Superfamily superfamily	a.101.1 — Uteroglobin-like
Family Family family	a.101.1.1 — Uteroglobin-like

Domain ID domain_id	d2ejnb2
Class class	a — All alpha proteins
Fold Fold fold	a.101 — Uteroglobin-like
Superfamily Superfamily superfamily	a.101.1 — Uteroglobin-like
Family Family family	a.101.1.1 — Uteroglobin-like

CATH v4.4 (2 domains)

Domain ID domain_id	2ejnA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	920 — Histone Acetyltransferase; Chain A
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	2ejnB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	920 — Histone Acetyltransferase; Chain A
Homologous superfamily homologous superfamily	50 —

▶

Unit-cell length a length_a	38.588 Å
Unit-cell length b length_b	42.996 Å
Unit-cell length c length_c	48.906 Å
Unit-cell angle α angle_alpha	70.80 °
Unit-cell angle β angle_beta	80.56 °
Unit-cell angle γ angle_gamma	81.53 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.640 Å
Low-resolution limit resolution_low	36.510 Å
R factor r_factor	0.1900
R_work r_work	0.1900
R_free r_free	0.2200

Structural characterization of the tetrameric form of the major cat allergen fel D 1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major allergen I polypeptide chain 1, chain 2

State in the Current Structure

Other States of the Same Protein in the Database

Major allergen I polypeptide chain 1, chain 2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2ejn__assembly_1__model_1

2ejn__assembly_1__model_1 | I(q)

2ejn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Structural characterization of the tetrameric form of the major cat allergen fel D 1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major allergen I polypeptide chain 1, chain 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Major allergen I polypeptide chain 1, chain 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2ejn__assembly_1__model_1

2ejn__assembly_1__model_1 | I(q)

2ejn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (1)