SAXSdb — 2f9z

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

chemotaxis protein CheC

Thermotoga maritima

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	PROTEIN (chemotaxis methylation protein) × 1 （Q9X005） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	PROTEIN (chemotaxis methylation protein) × 1 （Q9X005） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9X006_THEMA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–205； UniProt 1–205 Author chain B； PDBConstruct 1–205； UniProt 1–205

PROTEIN (chemotaxis methylation protein)

Thermotoga maritima

UniProt Q9X005

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	chemotaxis protein CheC × 1 （Q9X006） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	chemotaxis protein CheC × 1 （Q9X006） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9X005_THEMA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 3–159； UniProt 1–157 Author chain D； PDBConstruct 3–159； UniProt 1–157

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2f9z
Deposition date deposition_date	2005-12-06
Structure title title	Complex between the chemotaxis deamidase CheD and the chemotaxis phosphatase CheC from Thermotoga maritima
Keywords keywords	;bacterial chemotaxis, signal transduction, receptor deamidase, aspartyl phosphatase, protein complex, reciprocal regulation, SIGNALING PROTEIN ;; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2f9z__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2f9z__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2f9z__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.94 Å
Rg (electron density)	22.24 Å
Total Rg	23.03 Å
Atom count	2592
Residues	347
Excluded volume	47343 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2f9z__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2f9z__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	chemotaxis protein CheC
Molecular weight formula_weight	22567.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	5552

MKISERQKDLLKEIGNIGAGNAATAISYMINKKVEISVPNVEIVPISKVIFIAKDPEEIVVGVKMPVTGDIEGSVLLIMGTTVVKKILEILTGRAPDNLLNLDEFSASALREIGNIMCGTYVSALADFLGFKIDTLPPQLVIDMISAIFAEASIEELEDNSEDQIVFVETLLKVEEEEEPLTSYMMMIPKPGYLVKIFERMGIQE

Source Source

Source organism organism	Thermotoga maritima
NCBI taxonomy ID ncbi_taxonomy_id	243274
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	PROTEIN (chemotaxis methylation protein)
Molecular weight formula_weight	16893.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

AHMKKVIGIGEYAVMKNPGVIVTLGLGSCVAVCMRDPVAKVGAMAHVMLPDSGGKTDKPGKYADTAVKTLVEELKKMGAKVERLEAKIAGGASMFESKGMNIGARNVEAVKKHLKDFGIKLLAEDTGGNRARSVEYNIETGKLLVRKVGGGEQLEIKEI

Source Source

Source organism organism	Thermotoga maritima
NCBI taxonomy ID ncbi_taxonomy_id	243274
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	392

▼

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d2f9za_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.252 — CheC-like
Superfamily Superfamily superfamily	d.252.1 — CheC-like
Family Family family	d.252.1.1 — CheC-like

Domain ID domain_id	d2f9zb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.252 — CheC-like
Superfamily Superfamily superfamily	d.252.1 — CheC-like
Family Family family	d.252.1.1 — CheC-like

Domain ID domain_id	d2f9zc1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.194 — CNF1/YfiH-like putative cysteine hydrolases
Superfamily Superfamily superfamily	d.194.1 — CNF1/YfiH-like putative cysteine hydrolases
Family Family family	d.194.1.3 — CheD-like

Domain ID domain_id	d2f9zc2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2f9zd2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.194 — CNF1/YfiH-like putative cysteine hydrolases
Superfamily Superfamily superfamily	d.194.1 — CNF1/YfiH-like putative cysteine hydrolases
Family Family family	d.194.1.3 — CheD-like

Domain ID domain_id	d2f9zd3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (4 domains)

Domain ID domain_id	2f9zA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1550 — Chemotaxis protein chec
Homologous superfamily homologous superfamily	10 — CheC-like

Domain ID domain_id	2f9zB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1550 — Chemotaxis protein chec
Homologous superfamily homologous superfamily	10 — CheC-like

Domain ID domain_id	2f9zC00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	200 —

Domain ID domain_id	2f9zD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	200 —

▶

Unit-cell length a length_a	66.080 Å
Unit-cell length b length_b	66.080 Å
Unit-cell length c length_c	161.760 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 32
Space-group number int_tables_number	145
Crystal system crystal_system	—

Resolution resolution	2.400 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2110
R_work r_work	0.2110
R_free r_free	0.2750

Complex between the chemotaxis deamidase CheD and the chemotaxis phosphatase CheC from Thermotoga maritima

1. Protein Identity and Related Structures Protein Identity & Related Structures

chemotaxis protein CheC

State in the Current Structure

Other States of the Same Protein in the Database

PROTEIN (chemotaxis methylation protein)

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2f9z__assembly_1__model_1

2f9z__assembly_1__model_1 | I(q)

2f9z__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (6 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Complex between the chemotaxis deamidase CheD and the chemotaxis phosphatase CheC from Thermotoga maritima

1. Protein Identity and Related Structures Protein Identity & Related Structures

chemotaxis protein CheC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PROTEIN (chemotaxis methylation protein)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2f9z__assembly_1__model_1

2f9z__assembly_1__model_1 | I(q)

2f9z__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (6 domains)

CATH v4.4 (4 domains)

7. Citations (1)