2g18

Crystal Structure of Nostoc sp. 7120 phycocyanobilin:ferredoxin oxidoreductase (PcyA) Apoprotein

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycocyanobilin:ferredoxin oxidoreductase

Anabaena sp.

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
10	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
11	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
12	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
4	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
5	Protein monomer	Monomer	Protein 1	CALCIUM ION × 1 water × 1	Consistent with protein count
6	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
7	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
8	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
9	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PCYA_ANASP
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 10–253； UniProt 2–245 Author chain B； PDBConstruct 10–253； UniProt 2–245 Author chain C； PDBConstruct 10–253； UniProt 2–245 Author chain D； PDBConstruct 10–253； UniProt 2–245 Author chain E； PDBConstruct 10–253； UniProt 2–245 Author chain F； PDBConstruct 10–253； UniProt 2–245 Author chain G； PDBConstruct 10–253； UniProt 2–245 Author chain H； PDBConstruct 10–253； UniProt 2–245 Author chain I； PDBConstruct 10–253； UniProt 2–245 Author chain J； PDBConstruct 10–253； UniProt 2–245 Author chain K； PDBConstruct 10–253； UniProt 2–245 Author chain L； PDBConstruct 10–253； UniProt 2–245

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2g18
Deposition date deposition_date	2006-02-13
Structure title title	Crystal Structure of Nostoc sp. 7120 phycocyanobilin:ferredoxin oxidoreductase (PcyA) Apoprotein
Keywords keywords	alpha-beta-alpha sandwich, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2g18__assembly_5__model_1

Assembly 5 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2g18__assembly_5__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2g18__assembly_5__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.76 Å
Rg (electron density)	17.47 Å
Total Rg	18.48 Å
Atom count	1965
Residues	245
Excluded volume	34828 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2g18__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2g18__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2g18__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2g18__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`2g18__assembly_5__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`2g18__assembly_6__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`2g18__assembly_7__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`2g18__assembly_8__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`2g18__assembly_9__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
10	1	`2g18__assembly_10__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
11	1	`2g18__assembly_11__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
12	1	`2g18__assembly_12__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Phycocyanobilin:ferredoxin oxidoreductase
Molecular weight formula_weight	28755.6 kDa
EC 编号 ec_number	1.3.7.5
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L
Atom count atom_count	23613

GPLGSPEFISLTSIPSLREQQHPLIRQLADCIEEVWHQHLDLSPYHLPAELGYVEGRLEGEKLTIENRCYQTPQFRKMHLELAKVGNMLDILHCVMFPRPEYDLPMFGCDLVGGRGQISAAIADLSPVHLDRTLPESYNSALTSLNTLNFSQPRELPEWGNIFSDFCIFVRPSSPEEEAMFLGRVREFLQVHCQGAIAASPVSAEQKQQILAGQHNYCSKQQQNDKTRRVLEKAFGVDWAENYMTTVLFDLPE

Source Source

Source organism organism	Anabaena sp.
NCBI taxonomy ID ncbi_taxonomy_id	1167
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	190

▼

6. Fold Classification (SCOP + CATH) 32 domains

SCOP 2.08 (20 domains)

Domain ID domain_id	d2g18a1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.248 — Coproporphyrinogen III oxidase
Superfamily Superfamily superfamily	d.248.2 — Ferredoxin-dependent bilin reductase
Family Family family	d.248.2.1 — Ferredoxin-dependent bilin reductase

Domain ID domain_id	d2g18a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2g18b1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.248 — Coproporphyrinogen III oxidase
Superfamily Superfamily superfamily	d.248.2 — Ferredoxin-dependent bilin reductase
Family Family family	d.248.2.1 — Ferredoxin-dependent bilin reductase

Domain ID domain_id	d2g18b2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2g18c1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.248 — Coproporphyrinogen III oxidase
Superfamily Superfamily superfamily	d.248.2 — Ferredoxin-dependent bilin reductase
Family Family family	d.248.2.1 — Ferredoxin-dependent bilin reductase

Domain ID domain_id	d2g18c2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2g18d1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.248 — Coproporphyrinogen III oxidase
Superfamily Superfamily superfamily	d.248.2 — Ferredoxin-dependent bilin reductase
Family Family family	d.248.2.1 — Ferredoxin-dependent bilin reductase

Domain ID domain_id	d2g18d2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2g18e1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.248 — Coproporphyrinogen III oxidase
Superfamily Superfamily superfamily	d.248.2 — Ferredoxin-dependent bilin reductase
Family Family family	d.248.2.1 — Ferredoxin-dependent bilin reductase

Domain ID domain_id	d2g18e2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2g18f1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.248 — Coproporphyrinogen III oxidase
Superfamily Superfamily superfamily	d.248.2 — Ferredoxin-dependent bilin reductase
Family Family family	d.248.2.1 — Ferredoxin-dependent bilin reductase

Domain ID domain_id	d2g18f2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2g18g1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.248 — Coproporphyrinogen III oxidase
Superfamily Superfamily superfamily	d.248.2 — Ferredoxin-dependent bilin reductase
Family Family family	d.248.2.1 — Ferredoxin-dependent bilin reductase

Domain ID domain_id	d2g18g2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2g18h1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.248 — Coproporphyrinogen III oxidase
Superfamily Superfamily superfamily	d.248.2 — Ferredoxin-dependent bilin reductase
Family Family family	d.248.2.1 — Ferredoxin-dependent bilin reductase

Domain ID domain_id	d2g18h2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2g18i_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.248 — Coproporphyrinogen III oxidase
Superfamily Superfamily superfamily	d.248.2 — Ferredoxin-dependent bilin reductase
Family Family family	d.248.2.1 — Ferredoxin-dependent bilin reductase

Domain ID domain_id	d2g18j_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.248 — Coproporphyrinogen III oxidase
Superfamily Superfamily superfamily	d.248.2 — Ferredoxin-dependent bilin reductase
Family Family family	d.248.2.1 — Ferredoxin-dependent bilin reductase

Domain ID domain_id	d2g18k_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.248 — Coproporphyrinogen III oxidase
Superfamily Superfamily superfamily	d.248.2 — Ferredoxin-dependent bilin reductase
Family Family family	d.248.2.1 — Ferredoxin-dependent bilin reductase

Domain ID domain_id	d2g18l_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.248 — Coproporphyrinogen III oxidase
Superfamily Superfamily superfamily	d.248.2 — Ferredoxin-dependent bilin reductase
Family Family family	d.248.2.1 — Ferredoxin-dependent bilin reductase

CATH v4.4 (12 domains)

Domain ID domain_id	2g18A00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1500 — oxygen-dependent coproporphyrinogen oxidase
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2g18B00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1500 — oxygen-dependent coproporphyrinogen oxidase
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2g18C00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1500 — oxygen-dependent coproporphyrinogen oxidase
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2g18D00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1500 — oxygen-dependent coproporphyrinogen oxidase
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2g18E00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1500 — oxygen-dependent coproporphyrinogen oxidase
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2g18F00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1500 — oxygen-dependent coproporphyrinogen oxidase
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2g18G00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1500 — oxygen-dependent coproporphyrinogen oxidase
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2g18H00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1500 — oxygen-dependent coproporphyrinogen oxidase
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2g18I00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1500 — oxygen-dependent coproporphyrinogen oxidase
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2g18J00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1500 — oxygen-dependent coproporphyrinogen oxidase
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2g18K00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1500 — oxygen-dependent coproporphyrinogen oxidase
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2g18L00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1500 — oxygen-dependent coproporphyrinogen oxidase
Homologous superfamily homologous superfamily	20 —

▶

Unit-cell length a length_a	78.501 Å
Unit-cell length b length_b	141.332 Å
Unit-cell length c length_c	121.842 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	91.29 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	43.940 Å
R factor r_factor	0.2133
R_work r_work	0.2109
R_free r_free	0.2572

Crystal Structure of Nostoc sp. 7120 phycocyanobilin:ferredoxin oxidoreductase (PcyA) Apoprotein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycocyanobilin:ferredoxin oxidoreductase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2g18__assembly_5__model_1

2g18__assembly_5__model_1 | I(q)

2g18__assembly_5__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 32 domains

SCOP 2.08 (20 domains)

CATH v4.4 (12 domains)

7. Citations (1)

Crystal Structure of Nostoc sp. 7120 phycocyanobilin:ferredoxin oxidoreductase (PcyA) Apoprotein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phycocyanobilin:ferredoxin oxidoreductase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2g18__assembly_5__model_1

2g18__assembly_5__model_1 | I(q)

2g18__assembly_5__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 32 domains

SCOP 2.08 (20 domains)

CATH v4.4 (12 domains)

7. Citations (1)