2gtl

Lumbricus Erythrocruorin at 3.5A resolution

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Extracellular globin 4

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 180	Extracellular globin 2 × 36 （P02218） Extracellular globin-3 × 36 （P11069） Hemoglobin chain d1 × 36 （O61233） Hemoglobin linker chain L1 × 12 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 12 （Q2I743） Extracellular hemoglobin linker L3 subunit × 12 （Q2I742） CARBON MONOXIDE × 144 PROTOPORPHYRIN IX CONTAINING FE × 144 CALCIUM ION × 48 ZINC ION × 12	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 15	Extracellular globin 2 × 3 （P02218） Extracellular globin-3 × 3 （P11069） Hemoglobin chain d1 × 3 （O61233） Hemoglobin linker chain L1 × 1 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 1 （Q2I743） Extracellular hemoglobin linker L3 subunit × 1 （Q2I742） CARBON MONOXIDE × 12 PROTOPORPHYRIN IX CONTAINING FE × 12 CALCIUM ION × 4 ZINC ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 15	Extracellular globin 2 × 3 （P02218） Extracellular globin-3 × 3 （P11069） Hemoglobin chain d1 × 3 （O61233） Hemoglobin linker chain L1 × 1 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 1 （Q2I743） Extracellular hemoglobin linker L3 subunit × 1 （Q2I742） CARBON MONOXIDE × 12 PROTOPORPHYRIN IX CONTAINING FE × 12 CALCIUM ION × 4 ZINC ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 360	Extracellular globin 2 × 72 （P02218） Extracellular globin-3 × 72 （P11069） Hemoglobin chain d1 × 72 （O61233） Hemoglobin linker chain L1 × 24 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 24 （Q2I743） Extracellular hemoglobin linker L3 subunit × 24 （Q2I742） CARBON MONOXIDE × 288 PROTOPORPHYRIN IX CONTAINING FE × 288 CALCIUM ION × 96 ZINC ION × 24	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GLB4_LUMTE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–151； UniProt 1–151 Author chain E； PDBConstruct 1–151； UniProt 1–151 Author chain I； PDBConstruct 1–151； UniProt 1–151

Extracellular globin 2

OrganismNot specified

UniProt P02218

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 180	Extracellular globin 4 × 36 （P13579） Extracellular globin-3 × 36 （P11069） Hemoglobin chain d1 × 36 （O61233） Hemoglobin linker chain L1 × 12 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 12 （Q2I743） Extracellular hemoglobin linker L3 subunit × 12 （Q2I742） CARBON MONOXIDE × 144 PROTOPORPHYRIN IX CONTAINING FE × 144 CALCIUM ION × 48 ZINC ION × 12	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 15	Extracellular globin 4 × 3 （P13579） Extracellular globin-3 × 3 （P11069） Hemoglobin chain d1 × 3 （O61233） Hemoglobin linker chain L1 × 1 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 1 （Q2I743） Extracellular hemoglobin linker L3 subunit × 1 （Q2I742） CARBON MONOXIDE × 12 PROTOPORPHYRIN IX CONTAINING FE × 12 CALCIUM ION × 4 ZINC ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 15	Extracellular globin 4 × 3 （P13579） Extracellular globin-3 × 3 （P11069） Hemoglobin chain d1 × 3 （O61233） Hemoglobin linker chain L1 × 1 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 1 （Q2I743） Extracellular hemoglobin linker L3 subunit × 1 （Q2I742） CARBON MONOXIDE × 12 PROTOPORPHYRIN IX CONTAINING FE × 12 CALCIUM ION × 4 ZINC ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 360	Extracellular globin 4 × 72 （P13579） Extracellular globin-3 × 72 （P11069） Hemoglobin chain d1 × 72 （O61233） Hemoglobin linker chain L1 × 24 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 24 （Q2I743） Extracellular hemoglobin linker L3 subunit × 24 （Q2I742） CARBON MONOXIDE × 288 PROTOPORPHYRIN IX CONTAINING FE × 288 CALCIUM ION × 96 ZINC ION × 24	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GLB2_LUMTE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–145； UniProt 1–145 Author chain F； PDBConstruct 1–145； UniProt 1–145 Author chain J； PDBConstruct 1–145； UniProt 1–145

Extracellular globin-3

OrganismNot specified

UniProt P11069

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 180	Extracellular globin 4 × 36 （P13579） Extracellular globin 2 × 36 （P02218） Hemoglobin chain d1 × 36 （O61233） Hemoglobin linker chain L1 × 12 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 12 （Q2I743） Extracellular hemoglobin linker L3 subunit × 12 （Q2I742） CARBON MONOXIDE × 144 PROTOPORPHYRIN IX CONTAINING FE × 144 CALCIUM ION × 48 ZINC ION × 12	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 15	Extracellular globin 4 × 3 （P13579） Extracellular globin 2 × 3 （P02218） Hemoglobin chain d1 × 3 （O61233） Hemoglobin linker chain L1 × 1 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 1 （Q2I743） Extracellular hemoglobin linker L3 subunit × 1 （Q2I742） CARBON MONOXIDE × 12 PROTOPORPHYRIN IX CONTAINING FE × 12 CALCIUM ION × 4 ZINC ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 15	Extracellular globin 4 × 3 （P13579） Extracellular globin 2 × 3 （P02218） Hemoglobin chain d1 × 3 （O61233） Hemoglobin linker chain L1 × 1 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 1 （Q2I743） Extracellular hemoglobin linker L3 subunit × 1 （Q2I742） CARBON MONOXIDE × 12 PROTOPORPHYRIN IX CONTAINING FE × 12 CALCIUM ION × 4 ZINC ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 360	Extracellular globin 4 × 72 （P13579） Extracellular globin 2 × 72 （P02218） Hemoglobin chain d1 × 72 （O61233） Hemoglobin linker chain L1 × 24 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 24 （Q2I743） Extracellular hemoglobin linker L3 subunit × 24 （Q2I742） CARBON MONOXIDE × 288 PROTOPORPHYRIN IX CONTAINING FE × 288 CALCIUM ION × 96 ZINC ION × 24	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GLB3_LUMTE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–153； UniProt 18–170 Author chain G； PDBConstruct 1–153； UniProt 18–170 Author chain K； PDBConstruct 1–153； UniProt 18–170

Hemoglobin chain d1

OrganismNot specified

UniProt O61233

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 180	Extracellular globin 4 × 36 （P13579） Extracellular globin 2 × 36 （P02218） Extracellular globin-3 × 36 （P11069） Hemoglobin linker chain L1 × 12 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 12 （Q2I743） Extracellular hemoglobin linker L3 subunit × 12 （Q2I742） CARBON MONOXIDE × 144 PROTOPORPHYRIN IX CONTAINING FE × 144 CALCIUM ION × 48 ZINC ION × 12	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 15	Extracellular globin 4 × 3 （P13579） Extracellular globin 2 × 3 （P02218） Extracellular globin-3 × 3 （P11069） Hemoglobin linker chain L1 × 1 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 1 （Q2I743） Extracellular hemoglobin linker L3 subunit × 1 （Q2I742） CARBON MONOXIDE × 12 PROTOPORPHYRIN IX CONTAINING FE × 12 CALCIUM ION × 4 ZINC ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 15	Extracellular globin 4 × 3 （P13579） Extracellular globin 2 × 3 （P02218） Extracellular globin-3 × 3 （P11069） Hemoglobin linker chain L1 × 1 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 1 （Q2I743） Extracellular hemoglobin linker L3 subunit × 1 （Q2I742） CARBON MONOXIDE × 12 PROTOPORPHYRIN IX CONTAINING FE × 12 CALCIUM ION × 4 ZINC ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 360	Extracellular globin 4 × 72 （P13579） Extracellular globin 2 × 72 （P02218） Extracellular globin-3 × 72 （P11069） Hemoglobin linker chain L1 × 24 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 24 （Q2I743） Extracellular hemoglobin linker L3 subunit × 24 （Q2I742） CARBON MONOXIDE × 288 PROTOPORPHYRIN IX CONTAINING FE × 288 CALCIUM ION × 96 ZINC ION × 24	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O61233_LUMTE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–140； UniProt 19–158 Author chain H； PDBConstruct 1–140； UniProt 19–158 Author chain L； PDBConstruct 1–140； UniProt 19–158

Hemoglobin linker chain L1

OrganismNot specified

UniProt Q9GV76

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 180	Extracellular globin 4 × 36 （P13579） Extracellular globin 2 × 36 （P02218） Extracellular globin-3 × 36 （P11069） Hemoglobin chain d1 × 36 （O61233） Extracellular hemoglobin linker L2 subunit × 12 （Q2I743） Extracellular hemoglobin linker L3 subunit × 12 （Q2I742） CARBON MONOXIDE × 144 PROTOPORPHYRIN IX CONTAINING FE × 144 CALCIUM ION × 48 ZINC ION × 12	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 15	Extracellular globin 4 × 3 （P13579） Extracellular globin 2 × 3 （P02218） Extracellular globin-3 × 3 （P11069） Hemoglobin chain d1 × 3 （O61233） Extracellular hemoglobin linker L2 subunit × 1 （Q2I743） Extracellular hemoglobin linker L3 subunit × 1 （Q2I742） CARBON MONOXIDE × 12 PROTOPORPHYRIN IX CONTAINING FE × 12 CALCIUM ION × 4 ZINC ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 15	Extracellular globin 4 × 3 （P13579） Extracellular globin 2 × 3 （P02218） Extracellular globin-3 × 3 （P11069） Hemoglobin chain d1 × 3 （O61233） Extracellular hemoglobin linker L2 subunit × 1 （Q2I743） Extracellular hemoglobin linker L3 subunit × 1 （Q2I742） CARBON MONOXIDE × 12 PROTOPORPHYRIN IX CONTAINING FE × 12 CALCIUM ION × 4 ZINC ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 360	Extracellular globin 4 × 72 （P13579） Extracellular globin 2 × 72 （P02218） Extracellular globin-3 × 72 （P11069） Hemoglobin chain d1 × 72 （O61233） Extracellular hemoglobin linker L2 subunit × 24 （Q2I743） Extracellular hemoglobin linker L3 subunit × 24 （Q2I742） CARBON MONOXIDE × 288 PROTOPORPHYRIN IX CONTAINING FE × 288 CALCIUM ION × 96 ZINC ION × 24	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9GV76_LUMTE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain M； PDBConstruct 1–217； UniProt 24–240

Extracellular hemoglobin linker L2 subunit

OrganismNot specified

UniProt Q2I743

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 180	Extracellular globin 4 × 36 （P13579） Extracellular globin 2 × 36 （P02218） Extracellular globin-3 × 36 （P11069） Hemoglobin chain d1 × 36 （O61233） Hemoglobin linker chain L1 × 12 （Q9GV76） Extracellular hemoglobin linker L3 subunit × 12 （Q2I742） CARBON MONOXIDE × 144 PROTOPORPHYRIN IX CONTAINING FE × 144 CALCIUM ION × 48 ZINC ION × 12	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 15	Extracellular globin 4 × 3 （P13579） Extracellular globin 2 × 3 （P02218） Extracellular globin-3 × 3 （P11069） Hemoglobin chain d1 × 3 （O61233） Hemoglobin linker chain L1 × 1 （Q9GV76） Extracellular hemoglobin linker L3 subunit × 1 （Q2I742） CARBON MONOXIDE × 12 PROTOPORPHYRIN IX CONTAINING FE × 12 CALCIUM ION × 4 ZINC ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 15	Extracellular globin 4 × 3 （P13579） Extracellular globin 2 × 3 （P02218） Extracellular globin-3 × 3 （P11069） Hemoglobin chain d1 × 3 （O61233） Hemoglobin linker chain L1 × 1 （Q9GV76） Extracellular hemoglobin linker L3 subunit × 1 （Q2I742） CARBON MONOXIDE × 12 PROTOPORPHYRIN IX CONTAINING FE × 12 CALCIUM ION × 4 ZINC ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 360	Extracellular globin 4 × 72 （P13579） Extracellular globin 2 × 72 （P02218） Extracellular globin-3 × 72 （P11069） Hemoglobin chain d1 × 72 （O61233） Hemoglobin linker chain L1 × 24 （Q9GV76） Extracellular hemoglobin linker L3 subunit × 24 （Q2I742） CARBON MONOXIDE × 288 PROTOPORPHYRIN IX CONTAINING FE × 288 CALCIUM ION × 96 ZINC ION × 24	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q2I743_LUMTE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain N； PDBConstruct 1–220； UniProt 47–266

Extracellular hemoglobin linker L3 subunit

OrganismNot specified

UniProt Q2I742

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 180	Extracellular globin 4 × 36 （P13579） Extracellular globin 2 × 36 （P02218） Extracellular globin-3 × 36 （P11069） Hemoglobin chain d1 × 36 （O61233） Hemoglobin linker chain L1 × 12 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 12 （Q2I743） CARBON MONOXIDE × 144 PROTOPORPHYRIN IX CONTAINING FE × 144 CALCIUM ION × 48 ZINC ION × 12	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 15	Extracellular globin 4 × 3 （P13579） Extracellular globin 2 × 3 （P02218） Extracellular globin-3 × 3 （P11069） Hemoglobin chain d1 × 3 （O61233） Hemoglobin linker chain L1 × 1 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 1 （Q2I743） CARBON MONOXIDE × 12 PROTOPORPHYRIN IX CONTAINING FE × 12 CALCIUM ION × 4 ZINC ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 15	Extracellular globin 4 × 3 （P13579） Extracellular globin 2 × 3 （P02218） Extracellular globin-3 × 3 （P11069） Hemoglobin chain d1 × 3 （O61233） Hemoglobin linker chain L1 × 1 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 1 （Q2I743） CARBON MONOXIDE × 12 PROTOPORPHYRIN IX CONTAINING FE × 12 CALCIUM ION × 4 ZINC ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 360	Extracellular globin 4 × 72 （P13579） Extracellular globin 2 × 72 （P02218） Extracellular globin-3 × 72 （P11069） Hemoglobin chain d1 × 72 （O61233） Hemoglobin linker chain L1 × 24 （Q9GV76） Extracellular hemoglobin linker L2 subunit × 24 （Q2I743） CARBON MONOXIDE × 288 PROTOPORPHYRIN IX CONTAINING FE × 288 CALCIUM ION × 96 ZINC ION × 24	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q2I742_LUMTE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain O； PDBConstruct 1–215； UniProt 26–240

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2gtl
Deposition date deposition_date	2006-04-28
Structure title title	Lumbricus Erythrocruorin at 3.5A resolution
Keywords keywords	;Annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry, triple stranded helical coils, OXYGEN STORAGE-TRANSPORT COMPLEX ;; OXYGEN STORAGE/TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2gtl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2gtl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2gtl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	108.30 Å
Total Rg	108.30 Å
Atom count	235776
Residues	28740
Excluded volume	4160700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2gtl__assembly_1__model_1`	complete point assembly （180）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2gtl__assembly_2__model_1`	pentadecameric （15）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`2gtl__assembly_3__model_1`	pentadecameric （15）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`2gtl__assembly_4__model_1`	360-meric （360）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Description description	Extracellular globin 4
Molecular weight formula_weight	17567.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E,I
Atom count atom_count	19648

ADDEDCCSYEDRREIRHIWDDVWSSSFTDRRVAIVRAVFDDLFKHYPTSKALFERVKIDEPESGEFKSHLVRVANGLKLLINLLDDTLVLQSHLGHLADQHIQRKGVTKEYFRGIGEAFARVLPQVLSCFNVDAWNRCFHRLVARIAKDLP

Entity 2 Entity 2 polymer

Description description	Extracellular globin 2
Molecular weight formula_weight	16268.2 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F,J

KKQCGVLEGLKVKSEWGRAYGSGHDREAFSQAIWRATFAQVPESRSLFKRVHGDDTSHPAFIAHADRVLGGLDIAISTLDQPATLKEELDHLQVQHEGRKIPDNYFDAFKTAILHVVAAQLGRCYDREAWDACIDHIEDGIKGHH

Entity 3 Entity 3 polymer

Description description	Extracellular globin-3
Molecular weight formula_weight	17331.8 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G,K

DEHEHCCSEEDHRIVQKQWDILWRDTESSKIKIGFGRLLLTKLAKDIPEVNDLFKRVDIEHAEGPKFSAHALRILNGLDLAINLLDDPPALDAALDHLAHQHEVREGVQKAHFKKFGEILATGLPQVLDDYDALAWKSCLKGILTKISSRLNA

Entity 4 Entity 4 polymer

Description description	Hemoglobin chain d1
Molecular weight formula_weight	15988.3 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,H,L

ECLVTESLKVKLQWASAFGHAHERVAFGLELWRDIIDDHPEIKAPFSRVRGDNIYSPEFGAHSQRVLSGLDITISMLDTPDMLAAQLAHLKVQHVERNLKPEFFDIFLKHLLHVLGDRLGTHFDFGAWHDCVDQIIDGIK

Entity 5 Entity 5 polymer

Description description	Hemoglobin linker chain L1
Molecular weight formula_weight	24936.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

RFQYLVKNQNLHIDYLAKKLHDIEEEYNKLTHDVDKKTIRQLKARISNLEEHHCDEHESECRGDVPECIHDLLFCDGEKDCRDGSDEDPETCSLNITHVGSSYTGLATWTSCEDLNPDHAIVTITAAHRKSFFPNRVWLRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAPLKGQSEGYGVICDFNLGDDDHADCKIVVPSSLFVCAHFNAQRY

Entity 6 Entity 6 polymer

Description description	Extracellular hemoglobin linker L2 subunit
Molecular weight formula_weight	25057.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

LDPRLGANAFLIIRLDRIIEKLRTKLDEAEKIDPEHFVSEIDARVTKIEGTHCEKRTFQCGGNEQECISDLLVCDGHKDCHNAHDEDPDVCDTSVVKAGNVFSGTSTWHGCLAREDHVTRITITASKRRKFFTARIWLRALVESELERHGENVTSSFNAKGYYNFASRRLILLPTDDHDDHLAVVCSFNRGDNERAECHRVTEATLHQCADLFVTLEEHD

Entity 7 Entity 7 polymer

Description description	Extracellular hemoglobin linker L3 subunit
Molecular weight formula_weight	24486.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

QSHDEIIDKLIERTNKITTSISHVESLLDDRLDPKRIRKAGSLRHRVEELEDPSCDEHEHQCGGDDPQCISKLFVCDGHNDCRNGEDEKDCTLPTKAGDKFIGDVCFDHCTKRRPEHMTLAFESSSIAAFFTPIADLHVHIEIESETDEDESEVSMPADGEYSFADHRLTIHPPEEDGLGLVGEFDGYNFDRFVGHIVHELSEEVCAEFIFHRKK

Entity 8 Entity 8 non-polymer

Description description	CARBON MONOXIDE
Molecular weight formula_weight	28.0 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 9 Entity 9 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 10 Entity 10 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 11 Entity 11 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 39 domains

SCOP 2.08 (21 domains)

Domain ID domain_id	d2gtla1
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.2 — Globins

Domain ID domain_id	d2gtlb1
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.2 — Globins

Domain ID domain_id	d2gtlc1
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.2 — Globins

Domain ID domain_id	d2gtld1
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.2 — Globins

Domain ID domain_id	d2gtle1
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.2 — Globins

Domain ID domain_id	d2gtlf1
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.2 — Globins

Domain ID domain_id	d2gtlg1
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.2 — Globins

Domain ID domain_id	d2gtlh1
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.2 — Globins

Domain ID domain_id	d2gtli1
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.2 — Globins

Domain ID domain_id	d2gtlj1
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.2 — Globins

Domain ID domain_id	d2gtlk1
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.2 — Globins

Domain ID domain_id	d2gtll1
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.2 — Globins

Domain ID domain_id	d2gtlm1
Class class	b — All beta proteins
Fold Fold fold	b.61 — Streptavidin-like
Superfamily Superfamily superfamily	b.61.7 — Extracellular hemoglobin linker subunit, receptor domain
Family Family family	b.61.7.1 — Extracellular hemoglobin linker subunit, receptor domain

Domain ID domain_id	d2gtlm2
Class class	g — Small proteins
Fold Fold fold	g.12 — LDL receptor-like module
Superfamily Superfamily superfamily	g.12.1 — LDL receptor-like module
Family Family family	g.12.1.1 — LDL receptor-like module

Domain ID domain_id	d2gtlm3
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.32 — Heterotrimerisation domain of extracellular hemoglobin linker subunits
Family Family family	h.1.32.1 — Heterotrimerisation domain of extracellular hemoglobin linker subunits

Domain ID domain_id	d2gtln1
Class class	b — All beta proteins
Fold Fold fold	b.61 — Streptavidin-like
Superfamily Superfamily superfamily	b.61.7 — Extracellular hemoglobin linker subunit, receptor domain
Family Family family	b.61.7.1 — Extracellular hemoglobin linker subunit, receptor domain

Domain ID domain_id	d2gtln2
Class class	g — Small proteins
Fold Fold fold	g.12 — LDL receptor-like module
Superfamily Superfamily superfamily	g.12.1 — LDL receptor-like module
Family Family family	g.12.1.1 — LDL receptor-like module

Domain ID domain_id	d2gtln3
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.32 — Heterotrimerisation domain of extracellular hemoglobin linker subunits
Family Family family	h.1.32.1 — Heterotrimerisation domain of extracellular hemoglobin linker subunits

Domain ID domain_id	d2gtlo1
Class class	b — All beta proteins
Fold Fold fold	b.61 — Streptavidin-like
Superfamily Superfamily superfamily	b.61.7 — Extracellular hemoglobin linker subunit, receptor domain
Family Family family	b.61.7.1 — Extracellular hemoglobin linker subunit, receptor domain

Domain ID domain_id	d2gtlo2
Class class	g — Small proteins
Fold Fold fold	g.12 — LDL receptor-like module
Superfamily Superfamily superfamily	g.12.1 — LDL receptor-like module
Family Family family	g.12.1.1 — LDL receptor-like module

Domain ID domain_id	d2gtlo3
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.32 — Heterotrimerisation domain of extracellular hemoglobin linker subunits
Family Family family	h.1.32.1 — Heterotrimerisation domain of extracellular hemoglobin linker subunits

CATH v4.4 (18 domains)

Domain ID domain_id	2gtlA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	2gtlB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	2gtlC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	2gtlD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	2gtlE00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	2gtlF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	2gtlG00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	2gtlH00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	2gtlI00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	2gtlJ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	2gtlK00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	2gtlL00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	2gtlM01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1520 —

Domain ID domain_id	2gtlM02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	128 — Lipocalin
Homologous superfamily homologous superfamily	620 —

Domain ID domain_id	2gtlN01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1530 —

Domain ID domain_id	2gtlN02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	128 — Lipocalin
Homologous superfamily homologous superfamily	620 —

Domain ID domain_id	2gtlO01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1540 —

Domain ID domain_id	2gtlO02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	128 — Lipocalin
Homologous superfamily homologous superfamily	620 —

▶

Unit-cell length a length_a	176.080 Å
Unit-cell length b length_b	257.960 Å
Unit-cell length c length_c	436.530 Å
Unit-cell angle α angle_alpha	89.69 °
Unit-cell angle β angle_beta	97.15 °
Unit-cell angle γ angle_gamma	90.98 °
Molecules per unit cell Z z_pdb	72

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.500 Å
Low-resolution limit resolution_low	100.000 Å
R factor r_factor	0.2880
R_work r_work	0.2880
R_free r_free	0.2970

Lumbricus Erythrocruorin at 3.5A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Extracellular globin 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Extracellular globin 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Extracellular globin-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Hemoglobin chain d1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Hemoglobin linker chain L1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Extracellular hemoglobin linker L2 subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Extracellular hemoglobin linker L3 subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2gtl__assembly_1__model_1

2gtl__assembly_1__model_1 | I(q)

2gtl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer