2guz

Structure of the Tim14-Tim16 complex of the mitochondrial protein import motor

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial import inner membrane translocase subunit TIM14

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial import inner membrane translocase subunit TIM16 × 1 （P42949） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial import inner membrane translocase subunit TIM16 × 1 （P42949） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial import inner membrane translocase subunit TIM16 × 1 （P42949） CITRATE ANION × 2 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial import inner membrane translocase subunit TIM16 × 1 （P42949） water × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial import inner membrane translocase subunit TIM16 × 1 （P42949） CITRATE ANION × 1 water × 2	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial import inner membrane translocase subunit TIM16 × 1 （P42949） CITRATE ANION × 1 water × 2	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial import inner membrane translocase subunit TIM16 × 1 （P42949） water × 2	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial import inner membrane translocase subunit TIM16 × 1 （P42949） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIM14_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–71； UniProt 99–168 Author chain C； PDBConstruct 2–71； UniProt 99–168 Author chain E； PDBConstruct 2–71； UniProt 99–168 Author chain G； PDBConstruct 2–71； UniProt 99–168 Author chain I； PDBConstruct 2–71； UniProt 99–168 Author chain K； PDBConstruct 2–71； UniProt 99–168 Author chain M； PDBConstruct 2–71； UniProt 99–168 Author chain O； PDBConstruct 2–71； UniProt 99–168

Mitochondrial import inner membrane translocase subunit TIM16

Saccharomyces cerevisiae

UniProt P42949

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial import inner membrane translocase subunit TIM14 × 1 （Q07914） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial import inner membrane translocase subunit TIM14 × 1 （Q07914） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial import inner membrane translocase subunit TIM14 × 1 （Q07914） CITRATE ANION × 2 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial import inner membrane translocase subunit TIM14 × 1 （Q07914） water × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial import inner membrane translocase subunit TIM14 × 1 （Q07914） CITRATE ANION × 1 water × 2	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial import inner membrane translocase subunit TIM14 × 1 （Q07914） CITRATE ANION × 1 water × 2	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial import inner membrane translocase subunit TIM14 × 1 （Q07914） water × 2	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial import inner membrane translocase subunit TIM14 × 1 （Q07914） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIM16_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–65； UniProt 54–117 Author chain D； PDBConstruct 2–65； UniProt 54–117 Author chain F； PDBConstruct 2–65； UniProt 54–117 Author chain H； PDBConstruct 2–65； UniProt 54–117 Author chain J； PDBConstruct 2–65； UniProt 54–117 Author chain L； PDBConstruct 2–65； UniProt 54–117 Author chain N； PDBConstruct 2–65； UniProt 54–117 Author chain P； PDBConstruct 2–65； UniProt 54–117

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2guz
Deposition date deposition_date	2006-05-02
Structure title title	Structure of the Tim14-Tim16 complex of the mitochondrial protein import motor
Keywords keywords	DnaJ-fold, CHAPERONE, PROTEIN TRANSPORT; CHAPERONE, PROTEIN TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2guz__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2guz__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2guz__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.61 Å
Rg (electron density)	15.73 Å
Total Rg	16.82 Å
Atom count	1102
Residues	136
Excluded volume	19786 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2guz__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2guz__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2guz__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2guz__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`2guz__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`2guz__assembly_6__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`2guz__assembly_7__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`2guz__assembly_8__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Mitochondrial import inner membrane translocase subunit TIM14
Molecular weight formula_weight	7982.4 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G,I,K,M,O
Atom count atom_count	9819

GFLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGISK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Mitochondrial import inner membrane translocase subunit TIM16
Molecular weight formula_weight	7760.8 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,J,L,N,P

MTLDESCKILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	CITRATE ANION
Molecular weight formula_weight	189.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	921

▼

6. Fold Classification (SCOP + CATH) 16 domains

CATH v4.4 (16 domains)

Domain ID domain_id	2guzA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	110 — DnaJ domain

Domain ID domain_id	2guzB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	110 — DnaJ domain

Domain ID domain_id	2guzC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	110 — DnaJ domain

Domain ID domain_id	2guzD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	110 — DnaJ domain

Domain ID domain_id	2guzE00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	110 — DnaJ domain

Domain ID domain_id	2guzF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	110 — DnaJ domain

Domain ID domain_id	2guzG00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	110 — DnaJ domain

Domain ID domain_id	2guzH00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	110 — DnaJ domain

Domain ID domain_id	2guzI00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	110 — DnaJ domain

Domain ID domain_id	2guzJ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	110 — DnaJ domain

Domain ID domain_id	2guzK00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	110 — DnaJ domain

Domain ID domain_id	2guzL00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	110 — DnaJ domain

Domain ID domain_id	2guzM00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	110 — DnaJ domain

Domain ID domain_id	2guzN00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	110 — DnaJ domain

Domain ID domain_id	2guzO00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	110 — DnaJ domain

Domain ID domain_id	2guzP00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	110 — DnaJ domain

▶

Unit-cell length a length_a	111.591 Å
Unit-cell length b length_b	114.441 Å
Unit-cell length c length_c	162.191 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	32

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	15.000 Å
R factor r_factor	0.2078
R_work r_work	0.2054
R_free r_free	0.2526

Structure of the Tim14-Tim16 complex of the mitochondrial protein import motor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial import inner membrane translocase subunit TIM14

State in the Current Structure

Other States of the Same Protein in the Database

Mitochondrial import inner membrane translocase subunit TIM16

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2guz__assembly_2__model_1

2guz__assembly_2__model_1 | I(q)

2guz__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 16 domains

CATH v4.4 (16 domains)

7. Citations (1)

Structure of the Tim14-Tim16 complex of the mitochondrial protein import motor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial import inner membrane translocase subunit TIM14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial import inner membrane translocase subunit TIM16

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2guz__assembly_2__model_1

2guz__assembly_2__model_1 | I(q)

2guz__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 16 domains

CATH v4.4 (16 domains)

7. Citations (1)