SAXSdb — 2hdx

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

SH2-B PH domain containing signaling mediator 1 gamma isoform

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Jak2 protein × 1 （Q7TQD0） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Jak2 protein × 1 （Q7TQD0） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Jak2 protein × 1 （Q7TQD0） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Jak2 protein × 1 （Q7TQD0） water × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	Jak2 protein × 1 （Q7TQD0） water × 2	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	Jak2 protein × 1 （Q7TQD0） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9WVM5_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–111； UniProt 499–607 Author chain B； PDBConstruct 3–111； UniProt 499–607 Author chain C； PDBConstruct 3–111； UniProt 499–607 Author chain D； PDBConstruct 3–111； UniProt 499–607 Author chain E； PDBConstruct 3–111； UniProt 499–607 Author chain F； PDBConstruct 3–111； UniProt 499–607

Jak2 protein

OrganismNot specified

UniProt Q7TQD0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	SH2-B PH domain containing signaling mediator 1 gamma isoform × 1 （Q9WVM5） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	SH2-B PH domain containing signaling mediator 1 gamma isoform × 1 （Q9WVM5） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	SH2-B PH domain containing signaling mediator 1 gamma isoform × 1 （Q9WVM5） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	SH2-B PH domain containing signaling mediator 1 gamma isoform × 1 （Q9WVM5） water × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	SH2-B PH domain containing signaling mediator 1 gamma isoform × 1 （Q9WVM5） water × 2	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	SH2-B PH domain containing signaling mediator 1 gamma isoform × 1 （Q9WVM5） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7TQD0_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–11； UniProt 810–820 Author chain H； PDBConstruct 1–11； UniProt 810–820 Author chain I； PDBConstruct 1–11； UniProt 810–820 Author chain J； PDBConstruct 1–11； UniProt 810–820 Author chain K； PDBConstruct 1–11； UniProt 810–820 Author chain L； PDBConstruct 1–11； UniProt 810–820

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2hdx
Deposition date deposition_date	2006-06-21
Structure title title	Crystal structure of the Src homology-2 domain of SH2-B in complex with Jak2 pTyr813 phosphopeptide
Keywords keywords	SH2, Jak2, phosphotyrosine, adapter protein, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2hdx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2hdx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2hdx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	14.62 Å
Rg (electron density)	13.06 Å
Total Rg	14.39 Å
Atom count	916
Residues	116
Excluded volume	16232 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2hdx__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2hdx__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2hdx__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2hdx__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`2hdx__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`2hdx__assembly_6__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	SH2-B PH domain containing signaling mediator 1 gamma isoform
Molecular weight formula_weight	12276.0 kDa
Mutation mutation	E583A, E584A, W593H
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	5693

GSDQPLSGYPWFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETRRGECVLTFNFQGKAKHLRLSLNAAGQCRVQHLHFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPS

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Jak2 protein
Molecular weight formula_weight	1389.3 kDa
Source method src_method	syn
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I,J,K,L

TPDYELLTEND

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	320

▼

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d2hdxa_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.93 — SH2-like
Superfamily Superfamily superfamily	d.93.1 — SH2 domain
Family Family family	d.93.1.1 — SH2 domain

Domain ID domain_id	d2hdxb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.93 — SH2-like
Superfamily Superfamily superfamily	d.93.1 — SH2 domain
Family Family family	d.93.1.1 — SH2 domain

Domain ID domain_id	d2hdxc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.93 — SH2-like
Superfamily Superfamily superfamily	d.93.1 — SH2 domain
Family Family family	d.93.1.1 — SH2 domain

Domain ID domain_id	d2hdxd_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.93 — SH2-like
Superfamily Superfamily superfamily	d.93.1 — SH2 domain
Family Family family	d.93.1.1 — SH2 domain

Domain ID domain_id	d2hdxe_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.93 — SH2-like
Superfamily Superfamily superfamily	d.93.1 — SH2 domain
Family Family family	d.93.1.1 — SH2 domain

Domain ID domain_id	d2hdxf_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.93 — SH2-like
Superfamily Superfamily superfamily	d.93.1 — SH2 domain
Family Family family	d.93.1.1 — SH2 domain

CATH v4.4 (6 domains)

Domain ID domain_id	2hdxA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	505 — SHC Adaptor Protein
Homologous superfamily homologous superfamily	10 — SH2 domain

Domain ID domain_id	2hdxB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	505 — SHC Adaptor Protein
Homologous superfamily homologous superfamily	10 — SH2 domain

Domain ID domain_id	2hdxC00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	505 — SHC Adaptor Protein
Homologous superfamily homologous superfamily	10 — SH2 domain

Domain ID domain_id	2hdxD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	505 — SHC Adaptor Protein
Homologous superfamily homologous superfamily	10 — SH2 domain

Domain ID domain_id	2hdxE00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	505 — SHC Adaptor Protein
Homologous superfamily homologous superfamily	10 — SH2 domain

Domain ID domain_id	2hdxF00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	505 — SHC Adaptor Protein
Homologous superfamily homologous superfamily	10 — SH2 domain

▶

Unit-cell length a length_a	44.210 Å
Unit-cell length b length_b	74.190 Å
Unit-cell length c length_c	239.220 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.350 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2400
R_work r_work	0.2100
R_free r_free	0.2400

Crystal structure of the Src homology-2 domain of SH2-B in complex with Jak2 pTyr813 phosphopeptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

SH2-B PH domain containing signaling mediator 1 gamma isoform

State in the Current Structure

Other States of the Same Protein in the Database

Jak2 protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2hdx__assembly_1__model_1

2hdx__assembly_1__model_1 | I(q)

2hdx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

CATH v4.4 (6 domains)

7. Citations (1)

Crystal structure of the Src homology-2 domain of SH2-B in complex with Jak2 pTyr813 phosphopeptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

SH2-B PH domain containing signaling mediator 1 gamma isoform

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Jak2 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2hdx__assembly_1__model_1

2hdx__assembly_1__model_1 | I(q)

2hdx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

CATH v4.4 (6 domains)

7. Citations (1)