2hyb

Crystal Structure of Hexameric DsrEFH

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative sulfurtransferase dsrE

Allochromatium vinosum

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Intracellular sulfur oxidation protein dsrF × 2 （O87897） DsrH × 2 （O87898） water × 6	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Intracellular sulfur oxidation protein dsrF × 2 （O87897） DsrH × 2 （O87898） water × 6	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 6	Intracellular sulfur oxidation protein dsrF × 2 （O87897） DsrH × 2 （O87898） water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DSRE_CHRVI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–130； UniProt 1–130 Author chain D； PDBConstruct 1–130； UniProt 1–130 Author chain G； PDBConstruct 1–130； UniProt 1–130 Author chain J； PDBConstruct 1–130； UniProt 1–130 Author chain M； PDBConstruct 1–130； UniProt 1–130 Author chain P； PDBConstruct 1–130； UniProt 1–130

Intracellular sulfur oxidation protein dsrF

Allochromatium vinosum

UniProt O87897

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Putative sulfurtransferase dsrE × 2 （O87896） DsrH × 2 （O87898） water × 6	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Putative sulfurtransferase dsrE × 2 （O87896） DsrH × 2 （O87898） water × 6	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 6	Putative sulfurtransferase dsrE × 2 （O87896） DsrH × 2 （O87898） water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DSRF_CHRVI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–136； UniProt 1–136 Author chain E； PDBConstruct 1–136； UniProt 1–136 Author chain H； PDBConstruct 1–136； UniProt 1–136 Author chain K； PDBConstruct 1–136； UniProt 1–136 Author chain N； PDBConstruct 1–136； UniProt 1–136 Author chain Q； PDBConstruct 1–136； UniProt 1–136

DsrH

Allochromatium vinosum

UniProt O87898

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Putative sulfurtransferase dsrE × 2 （O87896） Intracellular sulfur oxidation protein dsrF × 2 （O87897） water × 6	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Putative sulfurtransferase dsrE × 2 （O87896） Intracellular sulfur oxidation protein dsrF × 2 （O87897） water × 6	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 6	Putative sulfurtransferase dsrE × 2 （O87896） Intracellular sulfur oxidation protein dsrF × 2 （O87897） water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O87898_CHRVI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–102； UniProt 1–102 Author chain F； PDBConstruct 1–102； UniProt 1–102 Author chain I； PDBConstruct 1–102； UniProt 1–102 Author chain L； PDBConstruct 1–102； UniProt 1–102 Author chain O； PDBConstruct 1–102； UniProt 1–102 Author chain R； PDBConstruct 1–102； UniProt 1–102

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2hyb
Deposition date deposition_date	2006-08-04
Structure title title	Crystal Structure of Hexameric DsrEFH
Keywords keywords	;DsrE, DsrF, DsrH, Sulfur, Structural Genomics, PSI, Protein Structure Initiative, Berkeley Structural Genomics Center, BSGC, TRANSFERASE ;; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2hyb__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2hyb__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2hyb__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.87 Å
Rg (electron density)	24.57 Å
Total Rg	25.46 Å
Atom count	5731
Residues	726
Excluded volume	101450 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2hyb__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2hyb__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2hyb__assembly_3__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Putative sulfurtransferase dsrE
Molecular weight formula_weight	14607.3 kDa
EC 编号 ec_number	2.8.1.-
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,G,J,M,P
Atom count atom_count	17611

MKFALQINEGPYQHQASDSAYQFAKAALEKGHEIFRVFFYHDGVNNSTRLTTPPQDDRHIVNRWAELAEQYELDMVVCVAAAQRRGIVDEGEASRNGKDATNIHPKFRISGLGQLVEAAIQADRLVVFGD

Source Source

Source organism organism	Allochromatium vinosum
NCBI taxonomy ID ncbi_taxonomy_id	1049
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Intracellular sulfur oxidation protein dsrF
Molecular weight formula_weight	15606.4 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E,H,K,N,Q

MSEVVKKFMYLNRKAPYGTIYAWEALEVVLIGAAFDQDVCVLFLDDGVYQLTRGQDTKGIGMKNFSPTYRTLGDYEVRRIYVDRDSLEARGLTQDDLVEIAFEDMETEEEFDNIVEVIDSARVSELMNESDAVFSF

Source Source

Source organism organism	Allochromatium vinosum
NCBI taxonomy ID ncbi_taxonomy_id	1049
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	DsrH
Molecular weight formula_weight	11094.6 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F,I,L,O,R

MSILHTVNKSPFERNSLESCLKFATEGASVLLFEDGIYAALAGTRVESQVTEALGKLKLYVLGPDLKARGFSDERVIPGISVVDYAGFVDLTTECDTVQAWL

Source Source

Source organism organism	Allochromatium vinosum
NCBI taxonomy ID ncbi_taxonomy_id	1049
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	418

▼

6. Fold Classification (SCOP + CATH) 36 domains

SCOP 2.08 (18 domains)

Domain ID domain_id	d2hyba_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.1 — DsrEF-like

Domain ID domain_id	d2hybb_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.1 — DsrEF-like

Domain ID domain_id	d2hybc_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.2 — DsrH-like

Domain ID domain_id	d2hybd_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.1 — DsrEF-like

Domain ID domain_id	d2hybe_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.1 — DsrEF-like

Domain ID domain_id	d2hybf_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.2 — DsrH-like

Domain ID domain_id	d2hybg_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.1 — DsrEF-like

Domain ID domain_id	d2hybh_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.1 — DsrEF-like

Domain ID domain_id	d2hybi_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.2 — DsrH-like

Domain ID domain_id	d2hybj_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.1 — DsrEF-like

Domain ID domain_id	d2hybk_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.1 — DsrEF-like

Domain ID domain_id	d2hybl_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.2 — DsrH-like

Domain ID domain_id	d2hybm_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.1 — DsrEF-like

Domain ID domain_id	d2hybn_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.1 — DsrEF-like

Domain ID domain_id	d2hybo_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.2 — DsrH-like

Domain ID domain_id	d2hybp_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.1 — DsrEF-like

Domain ID domain_id	d2hybq_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.1 — DsrEF-like

Domain ID domain_id	d2hybr_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.114 — DsrEFH-like
Superfamily Superfamily superfamily	c.114.1 — DsrEFH-like
Family Family family	c.114.1.2 — DsrH-like

CATH v4.4 (18 domains)

Domain ID domain_id	2hybA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

Domain ID domain_id	2hybB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

Domain ID domain_id	2hybC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

Domain ID domain_id	2hybD00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

Domain ID domain_id	2hybE00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

Domain ID domain_id	2hybF00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

Domain ID domain_id	2hybG00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

Domain ID domain_id	2hybH00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

Domain ID domain_id	2hybI00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

Domain ID domain_id	2hybJ00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

Domain ID domain_id	2hybK00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

Domain ID domain_id	2hybL00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

Domain ID domain_id	2hybM00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

Domain ID domain_id	2hybN00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

Domain ID domain_id	2hybO00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

Domain ID domain_id	2hybP00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

Domain ID domain_id	2hybQ00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

Domain ID domain_id	2hybR00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1260 — Hypothetical Protein Ychn; Chain: A,
Homologous superfamily homologous superfamily	10 — DsrEFH-like

▶

Unit-cell length a length_a	56.610 Å
Unit-cell length b length_b	183.110 Å
Unit-cell length c length_c	107.830 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	99.57 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	19.980 Å
R factor r_factor	0.2060
R_work r_work	0.2060
R_free r_free	0.2620

Crystal Structure of Hexameric DsrEFH

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative sulfurtransferase dsrE

State in the Current Structure

Other States of the Same Protein in the Database

Intracellular sulfur oxidation protein dsrF

State in the Current Structure

Other States of the Same Protein in the Database

DsrH

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2hyb__assembly_3__model_1

2hyb__assembly_3__model_1 | I(q)

2hyb__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 36 domains

SCOP 2.08 (18 domains)

CATH v4.4 (18 domains)

7. Citations (1)

Crystal Structure of Hexameric DsrEFH

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative sulfurtransferase dsrE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Intracellular sulfur oxidation protein dsrF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DsrH

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2hyb__assembly_3__model_1

2hyb__assembly_3__model_1 | I(q)

2hyb__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 36 domains

SCOP 2.08 (18 domains)

CATH v4.4 (18 domains)

7. Citations (1)