SAXSdb — 2it9

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein

Prochlorococcus marinus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	CHLORIDE ION × 1 TRIETHYLENE GLYCOL × 2 1,2-ETHANEDIOL × 1 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	TRIETHYLENE GLYCOL × 1 1,2-ETHANEDIOL × 3 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q46J75_PROMT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–127； UniProt 1–126 Author chain B； PDBConstruct 2–127； UniProt 1–126 Author chain C； PDBConstruct 2–127； UniProt 1–126 Author chain D； PDBConstruct 2–127； UniProt 1–126

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2it9
Deposition date deposition_date	2006-10-19
Structure title title	Crystal structure of a protein with unknown function from DUF155 family (YP_292156.1) from Prochlorococcus sp. NATL2A at 1.80 A resolution
Keywords keywords	;YP_292156.1, hypothetical protein, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, Structural Genomics-Unknown function COMPLEX ;; Structural Genomics/Unknown function
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2it9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2it9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2it9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.28 Å
Rg (electron density)	19.14 Å
Total Rg	20.12 Å
Atom count	1950
Residues	230
Excluded volume	34924 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2it9__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2it9__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Hypothetical protein
Molecular weight formula_weight	15046.3 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	4474

GMIKKEGPGWRIIFDSSRDNFSTLIGGETWAIELDKSEWKILVEVVMELCDQYKLVKEQLMGDEDITLELERRPWLAILNGDQYGWNLRLILSASGLFNRGAEVYWPRHVTNNVVNAMRSMWDSDYL

Source Source

Source organism organism	Prochlorococcus marinus
NCBI taxonomy ID ncbi_taxonomy_id	59920
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	TRIETHYLENE GLYCOL
Molecular weight formula_weight	150.2 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
Molecular weight formula_weight	122.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	386

▼

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (5 domains)

Domain ID domain_id	d2it9a1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.18 — ssDNA-binding transcriptional regulator domain
Superfamily Superfamily superfamily	d.18.1 — ssDNA-binding transcriptional regulator domain
Family Family family	d.18.1.3 — PMN2A0962/syc2379c-like

Domain ID domain_id	d2it9a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2it9b_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.18 — ssDNA-binding transcriptional regulator domain
Superfamily Superfamily superfamily	d.18.1 — ssDNA-binding transcriptional regulator domain
Family Family family	d.18.1.3 — PMN2A0962/syc2379c-like

Domain ID domain_id	d2it9c_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.18 — ssDNA-binding transcriptional regulator domain
Superfamily Superfamily superfamily	d.18.1 — ssDNA-binding transcriptional regulator domain
Family Family family	d.18.1.3 — PMN2A0962/syc2379c-like

Domain ID domain_id	d2it9d_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.18 — ssDNA-binding transcriptional regulator domain
Superfamily Superfamily superfamily	d.18.1 — ssDNA-binding transcriptional regulator domain
Family Family family	d.18.1.3 — PMN2A0962/syc2379c-like

CATH v4.4 (4 domains)

Domain ID domain_id	2it9A00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	31 — Transcriptional Co-activator pc4; Chain A
Homologous superfamily homologous superfamily	10 — Transcriptional Coactivator Pc4; Chain A

Domain ID domain_id	2it9B00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	31 — Transcriptional Co-activator pc4; Chain A
Homologous superfamily homologous superfamily	10 — Transcriptional Coactivator Pc4; Chain A

Domain ID domain_id	2it9C00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	31 — Transcriptional Co-activator pc4; Chain A
Homologous superfamily homologous superfamily	10 — Transcriptional Coactivator Pc4; Chain A

Domain ID domain_id	2it9D00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	31 — Transcriptional Co-activator pc4; Chain A
Homologous superfamily homologous superfamily	10 — Transcriptional Coactivator Pc4; Chain A

▶

Unit-cell length a length_a	59.723 Å
Unit-cell length b length_b	81.021 Å
Unit-cell length c length_c	124.352 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	67.884 Å
R factor r_factor	0.1810
R_work r_work	0.1790
R_free r_free	0.2130

Crystal structure of a protein with unknown function from DUF155 family (YP_292156.1) from Prochlorococcus sp. NATL2A at 1.80 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2it9__assembly_1__model_1

2it9__assembly_1__model_1 | I(q)

2it9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (5 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of a protein with unknown function from DUF155 family (YP_292156.1) from Prochlorococcus sp. NATL2A at 1.80 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2it9__assembly_1__model_1

2it9__assembly_1__model_1 | I(q)

2it9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (5 domains)

CATH v4.4 (4 domains)

7. Citations (1)