SAXSdb — 2jes

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PORTAL PROTEIN

BACTERIOPHAGE SPP1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	UNIDENTIFIED FRAGMENT OF PORTAL PROTEIN × 13 MERCURY (II) ION × 13 CALCIUM ION × 13	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SIZ_BPSPP
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–503； UniProt 1–503 Author chain C； PDBConstruct 1–503； UniProt 1–503 Author chain E； PDBConstruct 1–503； UniProt 1–503 Author chain G； PDBConstruct 1–503； UniProt 1–503 Author chain I； PDBConstruct 1–503； UniProt 1–503 Author chain K； PDBConstruct 1–503； UniProt 1–503 Author chain M； PDBConstruct 1–503； UniProt 1–503 Author chain O； PDBConstruct 1–503； UniProt 1–503 Author chain Q； PDBConstruct 1–503； UniProt 1–503 Author chain S； PDBConstruct 1–503； UniProt 1–503 Author chain U； PDBConstruct 1–503； UniProt 1–503 Author chain W； PDBConstruct 1–503； UniProt 1–503 Author chain Y； PDBConstruct 1–503； UniProt 1–503

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2jes
Deposition date deposition_date	2007-01-21
Structure title title	Portal protein (gp6) from bacteriophage SPP1
Keywords keywords	BACTERIOPHAGE SPP1, DNA TRANSLOCATION, MOLECULAR MOTOR, VIRAL PORTAL PROTEIN, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2jes__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2jes__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2jes__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.14 Å
Rg (electron density)	54.73 Å
Total Rg	54.62 Å
Atom count	39260
Residues	5200
Excluded volume	692250 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2jes__assembly_1__model_1`	26-meric （26）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	PORTAL PROTEIN
Molecular weight formula_weight	57405.4 kDa
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	13

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G,I,K,M,O,Q,S,U,W,Y
Atom count atom_count	39260

MADIYPLGKTHTEELNEIIVESAKEIAEPDTTMIQKLIDEHNPEPLLKGVRYYMCENDIEKKRRTYYDAAGQQLVDDTKTNNRTSHAWHKLFVDQKTQYLVGEPVTFTSDNKTLLEYVNELADDDFDDILNETVKNMSNKGIEYWHPFVDEEGEFDYVIFPAEEMIVVYKDNTRRDILFALRYYSYKGIMGEETQKAELYTDTHVYYYEKIDGVYQMDYSYGENNPRPHMTKGGQAIGWGRVPIIPFKNNEEMVSDLKFYKDLIDNYDSITSSTMDSFSDFQQIVYVLKNYDGENPKEFTANLRYHSVIKVSGDGGVDTLRAEIPVDSAAKELERIQDELYKSAQAVDNSPETIGGGATGPALEKLYALLDLKANMAERKIRAGLRLFFWFFAEYLRNTGKGDFNPDKELTMTFTRTRIQNDSEIVQSLVQGVTGGIMSKETAVARNPFVQDPEEELARIEEEMNQYAEMQGNLLDDEGGDDDLEEDDPNAGAAESGGAGQVS

Source Source

Source organism organism	BACTERIOPHAGE SPP1
NCBI taxonomy ID ncbi_taxonomy_id	10724
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	UNIDENTIFIED FRAGMENT OF PORTAL PROTEIN
Molecular weight formula_weight	2571.2 kDa
Source method src_method	man
Copy count entity_count	13

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,J,L,N,P,R,T,V,X,Z

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	BACTERIOPHAGE SPP1
NCBI taxonomy ID ncbi_taxonomy_id	10724
Host organism host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 non-polymer

Description description	MERCURY (II) ION
Molecular weight formula_weight	200.6 kDa
Source method src_method	syn
Copy count entity_count	13

Entity 4 Entity 4 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	13

▶

Unit-cell length a length_a	174.314 Å
Unit-cell length b length_b	221.405 Å
Unit-cell length c length_c	421.866 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	104

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	3.400 Å
Low-resolution limit resolution_low	39.810 Å
R factor r_factor	0.2890
R_work r_work	0.2880
R_free r_free	0.3190

Portal protein (gp6) from bacteriophage SPP1

1. Protein Identity and Related Structures Protein Identity & Related Structures

PORTAL PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2jes__assembly_1__model_1

2jes__assembly_1__model_1 | I(q)

2jes__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

7. Citations (3)

Portal protein (gp6) from bacteriophage SPP1

1. Protein Identity and Related Structures Protein Identity & Related Structures

PORTAL PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2jes__assembly_1__model_1

2jes__assembly_1__model_1 | I(q)

2jes__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

7. Citations (3)