SAXSdb — 2jft

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

SER-THR PHOSPHATASE MSPP

MYCOBACTERIUM SMEGMATIS

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	MAGNESIUM ION × 5 MANGANESE (II) ION × 1 SULFATE ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0QTQ6_MYCSM
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–234； UniProt 1–233

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2jft
Deposition date deposition_date	2007-02-04
Structure title title	Crystal structure of the PPM Ser-Thr phosphatase MsPP from Mycobacterium smegmatis in complex with sulfate
Keywords keywords	HYDROLASE, PPM PHOSPHATASE, MYCOBACTERIUM, MANGANESE, SULFATE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2jft__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2jft__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2jft__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	17.82 Å
Rg (electron density)	16.69 Å
Total Rg	17.61 Å
Atom count	1717
Residues	234
Excluded volume	30083 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2jft__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	SER-THR PHOSPHATASE MSPP
Molecular weight formula_weight	24278.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2261

GMASVLSAATATDQGPVRENNQDACLADGILYAVADGFGARGHHASATALKTLSAGFAAAPDRDGLLEAVQQANLRVFELLGDEPTVSGTTLTAVAVFEPGQGGPLVVNIGDSPLYRIRDGHMEQLTDDHSVAGELVRMGEITRHEARWHPQRHLLTRALGIGPHIGPDVFGIDCGPGDRLLISSDGLFAAADEALIVDAATSPDPQVAVRRLVEVANDAGGSDNTTVVVIDLG

Source Source

Source organism organism	MYCOBACTERIUM SMEGMATIS
NCBI taxonomy ID ncbi_taxonomy_id	246196
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 3 Entity 3 non-polymer

Description description	MANGANESE (II) ION
Molecular weight formula_weight	54.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	415

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d2jfta_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.219 — PP2C-like
Superfamily Superfamily superfamily	d.219.1 — PP2C-like
Family Family family	d.219.1.0 — automated matches

CATH v4.4 (1 domains)

Domain ID domain_id	2jftA00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	40 — Phosphatase 2c; domain 1
Homologous superfamily homologous superfamily	10 — PPM-type phosphatase domain

▶

Unit-cell length a length_a	76.547 Å
Unit-cell length b length_b	84.402 Å
Unit-cell length c length_c	33.609 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	1.080 Å
Low-resolution limit resolution_low	6.000 Å
R factor r_factor	0.1155
R_work r_work	—
R_free r_free	0.1603

Crystal structure of the PPM Ser-Thr phosphatase MsPP from Mycobacterium smegmatis in complex with sulfate

1. Protein Identity and Related Structures Protein Identity & Related Structures

SER-THR PHOSPHATASE MSPP

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2jft__assembly_1__model_1

2jft__assembly_1__model_1 | I(q)

2jft__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (1)

Crystal structure of the PPM Ser-Thr phosphatase MsPP from Mycobacterium smegmatis in complex with sulfate

1. Protein Identity and Related Structures Protein Identity & Related Structures

SER-THR PHOSPHATASE MSPP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2jft__assembly_1__model_1

2jft__assembly_1__model_1 | I(q)

2jft__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (1)