SAXSdb — 2kbm

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

F-actin-capping protein subunit alpha-2

Rattus norvegicus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Protein S100-A1 × 2 （P35467） CALCIUM ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAZA2_RAT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain X； PDBConstruct 1–12； UniProt 265–276 Author chain Y； PDBConstruct 1–12； UniProt 265–276

Protein S100-A1

Rattus norvegicus

UniProt P35467

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	F-actin-capping protein subunit alpha-2 × 2 （Q3T1K5） CALCIUM ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S10A1_RAT
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–93； UniProt 2–94 Author chain B； PDBConstruct 1–93； UniProt 2–94

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2kbm
Deposition date deposition_date	2008-12-02
Structure title title	Ca-S100A1 interacting with TRTK12
Keywords keywords	;S100, EF-hand, Protein-protein interaction, conformational change, CapZ, Acetylation, Actin capping, Actin-binding, Calcium, Cytoplasm, Metal-binding, Zinc, METAL BINDING PROTEIN ;; METAL BINDING PROTEIN
Experimental Method method	SOLUTION NMR

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2kbm__assembly_1__model_9

Assembly 1 · Model 9 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2kbm__assembly_1__model_9 | I(q)

100 plotted points; both axes use logarithmic scales.

2kbm__assembly_1__model_9 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.15 Å
Rg (electron density)	17.74 Å
Total Rg	18.74 Å
Atom count	3322
Residues	210
Excluded volume	29976 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2kbm__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	2	`2kbm__assembly_1__model_2`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	3	`2kbm__assembly_1__model_3`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	4	`2kbm__assembly_1__model_4`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	5	`2kbm__assembly_1__model_5`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	6	`2kbm__assembly_1__model_6`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	7	`2kbm__assembly_1__model_7`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	8	`2kbm__assembly_1__model_8`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	9	`2kbm__assembly_1__model_9`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	10	`2kbm__assembly_1__model_10`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	11	`2kbm__assembly_1__model_11`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	12	`2kbm__assembly_1__model_12`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	13	`2kbm__assembly_1__model_13`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	14	`2kbm__assembly_1__model_14`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	15	`2kbm__assembly_1__model_15`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	16	`2kbm__assembly_1__model_16`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	17	`2kbm__assembly_1__model_17`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	18	`2kbm__assembly_1__model_18`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	19	`2kbm__assembly_1__model_19`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	20	`2kbm__assembly_1__model_20`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	F-actin-capping protein subunit alpha-2
Molecular weight formula_weight	1477.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,Y
Atom count atom_count	66440

TRTKIDWNKILS

Source Source

Source organism organism	Rattus norvegicus
Common name common_name	rat
NCBI taxonomy ID ncbi_taxonomy_id	10116
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Protein S100-A1
Molecular weight formula_weight	10439.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B

GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS

Source Source

Source organism organism	Rattus norvegicus
Common name common_name	rat
NCBI taxonomy ID ncbi_taxonomy_id	10116
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	4

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d2kbma_
Class class	a — All alpha proteins
Fold Fold fold	a.39 — EF Hand-like
Superfamily Superfamily superfamily	a.39.1 — EF-hand
Family Family family	a.39.1.2 — S100 proteins

Domain ID domain_id	d2kbmb_
Class class	a — All alpha proteins
Fold Fold fold	a.39 — EF Hand-like
Superfamily Superfamily superfamily	a.39.1 — EF-hand
Family Family family	a.39.1.2 — S100 proteins

CATH v4.4 (2 domains)

Domain ID domain_id	2kbmA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	2kbmB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

▶

Ca-S100A1 interacting with TRTK12

1. Protein Identity and Related Structures Protein Identity & Related Structures

F-actin-capping protein subunit alpha-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein S100-A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2kbm__assembly_1__model_9

2kbm__assembly_1__model_9 | I(q)

2kbm__assembly_1__model_9 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)