SAXSdb — 2mru

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Antitoxin MazE

Escherichia coli K-12

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Homooligomer	Protein 2 DNA 2	;DNA (5'-D(CPGPTPGPAPTPAPTPAPTPAPGPTPGPC)-3') ; × 1 ;DNA (5'-D(PGPCPAPCPTPAPTPAPTPAPTPCPAPCPG)-3') ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MAZE_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 19–67； UniProt 2–50 Author chain B； PDBConstruct 19–67； UniProt 2–50

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2mru
Deposition date deposition_date	2014-07-15
Structure title title	Structure of truncated EcMazE-DNA complex
Keywords keywords	MazE, antitoxin, DNA-binding domain, protein-DNA complex, transcription, DNA BINDING PROTEIN-DNA complex; DNA BINDING PROTEIN/DNA
Experimental Method method	SOLUTION NMR

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2mru__assembly_1__model_7

Assembly 1 · Model 7 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2mru__assembly_1__model_7 | I(q)

100 plotted points; both axes use logarithmic scales.

2mru__assembly_1__model_7 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	17.86 Å
Rg (electron density)	16.62 Å
Total Rg	17.53 Å
Atom count	1909
Residues	130
Excluded volume	23020 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2mru__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	2	`2mru__assembly_1__model_2`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	3	`2mru__assembly_1__model_3`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	4	`2mru__assembly_1__model_4`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	5	`2mru__assembly_1__model_5`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	6	`2mru__assembly_1__model_6`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	7	`2mru__assembly_1__model_7`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Antitoxin MazE
Molecular weight formula_weight	7675.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	13363

NHKVHHHHHHMSDDDDKGIHSSVKRWGNSPAVRIPATLMQALNLNIDDEVKIDLVDGKLIIEPVRKE

Source Source

Source organism organism	Escherichia coli K-12
NCBI taxonomy ID ncbi_taxonomy_id	83333
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	;DNA (5'-D(CPGPTPGPAPTPAPTPAPTPAPGPTPGP*C)-3') ;
Molecular weight formula_weight	4624.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	X

CGTGATATATAGTGC

Entity 3 Entity 3 polymer

Description description	;DNA (5'-D(PGPCPAPCPTPAPTPAPTPAPTPCPAPCP*G)-3') ;
Molecular weight formula_weight	4553.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	Y

GCACTATATATCACG

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2mrua1
Class class	b — All beta proteins
Fold Fold fold	b.129 — Double-split beta-barrel
Superfamily Superfamily superfamily	b.129.1 — AbrB/MazE/MraZ-like
Family Family family	b.129.1.1 — Kis/PemI addiction antidote

Domain ID domain_id	d2mrua2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2mrub1
Class class	b — All beta proteins
Fold Fold fold	b.129 — Double-split beta-barrel
Superfamily Superfamily superfamily	b.129.1 — AbrB/MazE/MraZ-like
Family Family family	b.129.1.1 — Kis/PemI addiction antidote

Domain ID domain_id	d2mrub2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

▶

Structure of truncated EcMazE-DNA complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Antitoxin MazE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2mru__assembly_1__model_7

2mru__assembly_1__model_7 | I(q)

2mru__assembly_1__model_7 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

7. Citations (1)