SAXSdb — 2o1j

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nonstructural protein NSP4

Rotavirus str.

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	CALCIUM ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9PYC1_9REOV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–52； UniProt 95–146 Author chain B； PDBConstruct 1–52； UniProt 95–146 Author chain C； PDBConstruct 1–52； UniProt 95–146 Author chain D； PDBConstruct 1–52； UniProt 95–146

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2o1j
Deposition date deposition_date	2006-11-29
Structure title title	Structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein NSP4
Keywords keywords	Rotavirus enterotoxin, Non structural protein, NSP4, tetrameric coiled coil, Virulence, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2o1j__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2o1j__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2o1j__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.77 Å
Rg (electron density)	19.29 Å
Total Rg	19.94 Å
Atom count	1329
Residues	174
Excluded volume	24035 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2o1j__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Nonstructural protein NSP4
Molecular weight formula_weight	6364.5 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	1340

IETQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVRTADEIDMTK

Source Source

Source organism organism	Rotavirus str.
NCBI taxonomy ID ncbi_taxonomy_id	12578
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	11

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2o1ja_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.13 — Rotavirus nonstructural proteins
Family Family family	h.1.13.1 — NSP4 oligomerization domain

Domain ID domain_id	d2o1jb_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.13 — Rotavirus nonstructural proteins
Family Family family	h.1.13.1 — NSP4 oligomerization domain

Domain ID domain_id	d2o1jc_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.13 — Rotavirus nonstructural proteins
Family Family family	h.1.13.1 — NSP4 oligomerization domain

Domain ID domain_id	d2o1jd_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.13 — Rotavirus nonstructural proteins
Family Family family	h.1.13.1 — NSP4 oligomerization domain

CATH v4.4 (4 domains)

Domain ID domain_id	2o1jA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	430 —

Domain ID domain_id	2o1jB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	430 —

Domain ID domain_id	2o1jC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	430 —

Domain ID domain_id	2o1jD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	430 —

▶

Unit-cell length a length_a	48.614 Å
Unit-cell length b length_b	180.432 Å
Unit-cell length c length_c	48.691 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	32

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	15.000 Å
R factor r_factor	0.2507
R_work r_work	0.2477
R_free r_free	0.3138

Structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein NSP4

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nonstructural protein NSP4

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2o1j__assembly_1__model_1

2o1j__assembly_1__model_1 | I(q)

2o1j__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein NSP4

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nonstructural protein NSP4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2o1j__assembly_1__model_1

2o1j__assembly_1__model_1 | I(q)

2o1j__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)