SAXSdb — 2o35

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein DUF1244

Sinorhizobium meliloti

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	MAGNESIUM ION × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q92M60_RHIME
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–103； UniProt 1–101 Author chain B； PDBConstruct 3–103； UniProt 1–101

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2o35
Deposition date deposition_date	2006-11-30
Structure title title	Protein of Unknown Function (DUF1244) from Sinorhizobium meliloti
Keywords keywords	;helix bundle, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION ;; STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2o35__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2o35__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2o35__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.32 Å
Rg (electron density)	21.38 Å
Total Rg	22.15 Å
Atom count	2848
Residues	336
Excluded volume	49731 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2o35__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Hypothetical protein DUF1244
Molecular weight formula_weight	12341.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1667

GHMSEISPEQRTAFEAAVFRRLLEHLRERSDVQNIDLMNLAGFCRNCLSNWYREAAEASGVPMSKEESREIVYGMPYEEWRTQNQGEASPEQKAAFERNRPKEGS

Source Source

Source organism organism	Sinorhizobium meliloti
NCBI taxonomy ID ncbi_taxonomy_id	382
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	117

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d2o35a1
Class class	a — All alpha proteins
Fold Fold fold	a.293 — SMc04008-like
Superfamily Superfamily superfamily	a.293.1 — SMc04008-like
Family Family family	a.293.1.1 — SMc04008-like

Domain ID domain_id	d2o35b_
Class class	a — All alpha proteins
Fold Fold fold	a.293 — SMc04008-like
Superfamily Superfamily superfamily	a.293.1 — SMc04008-like
Family Family family	a.293.1.1 — SMc04008-like

CATH v4.4 (2 domains)

Domain ID domain_id	2o35A00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3340 — SMc04008-like fold
Homologous superfamily homologous superfamily	10 — SMc04008-like

Domain ID domain_id	2o35B00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3340 — SMc04008-like fold
Homologous superfamily homologous superfamily	10 — SMc04008-like

▶

Unit-cell length a length_a	80.994 Å
Unit-cell length b length_b	80.994 Å
Unit-cell length c length_c	64.708 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 31 2 1
Space-group number int_tables_number	152
Crystal system crystal_system	—

Resolution resolution	2.120 Å
Low-resolution limit resolution_low	35.070 Å
R factor r_factor	0.2141
R_work r_work	0.2086
R_free r_free	0.2629

Protein of Unknown Function (DUF1244) from Sinorhizobium meliloti

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein DUF1244

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2o35__assembly_1__model_1

2o35__assembly_1__model_1 | I(q)

2o35__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Protein of Unknown Function (DUF1244) from Sinorhizobium meliloti

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein DUF1244

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2o35__assembly_1__model_1

2o35__assembly_1__model_1 | I(q)

2o35__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)