SAXSdb — 2oee

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

UPF0342 protein yheA

Bacillus subtilis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	CALCIUM ION × 2 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	CALCIUM ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YHEA_BACSU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–117； UniProt 1–117 Author chain B； PDBConstruct 1–117； UniProt 1–117

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2oee
Deposition date deposition_date	2006-12-29
Structure title title	yheA from Bacillus subtilis
Keywords keywords	yheA, MCSG, structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, UNKNOWN FUNCTION; STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2oee__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2oee__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2oee__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.36 Å
Rg (electron density)	21.40 Å
Total Rg	22.06 Å
Atom count	1522
Residues	174
Excluded volume	27292 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2oee__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2oee__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	UPF0342 protein yheA
Molecular weight formula_weight	13934.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1809

MAVNFYDVAYDLENALRGSEEFTRLKNLYDEVNADESAKRMFENFRDVQLRLQQKQMAGEEITQEEVTQAQKTVALVQQHEKISQLMEAEQRMSMLIGELNKIIMKPLEELYGSVEG

Source Source

Source organism organism	Bacillus subtilis
NCBI taxonomy ID ncbi_taxonomy_id	1423
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	271

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d2oeea1
Class class	a — All alpha proteins
Fold Fold fold	a.281 — YheA-like
Superfamily Superfamily superfamily	a.281.1 — YheA/YmcA-like
Family Family family	a.281.1.2 — YheA-like

Domain ID domain_id	d2oeeb_
Class class	a — All alpha proteins
Fold Fold fold	a.281 — YheA-like
Superfamily Superfamily superfamily	a.281.1 — YheA/YmcA-like
Family Family family	a.281.1.2 — YheA-like

CATH v4.4 (2 domains)

Domain ID domain_id	2oeeA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1500 — YheA-like fold
Homologous superfamily homologous superfamily	10 — YheA/YmcA-like

Domain ID domain_id	2oeeB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1500 — YheA-like fold
Homologous superfamily homologous superfamily	10 — YheA/YmcA-like

▶

Unit-cell length a length_a	53.246 Å
Unit-cell length b length_b	53.246 Å
Unit-cell length c length_c	166.348 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	—

Resolution resolution	1.960 Å
Low-resolution limit resolution_low	46.130 Å
R factor r_factor	0.2183
R_work r_work	0.2166
R_free r_free	0.2492

yheA from Bacillus subtilis

1. Protein Identity and Related Structures Protein Identity & Related Structures

UPF0342 protein yheA

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2oee__assembly_1__model_1

2oee__assembly_1__model_1 | I(q)

2oee__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

yheA from Bacillus subtilis

1. Protein Identity and Related Structures Protein Identity & Related Structures

UPF0342 protein yheA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2oee__assembly_1__model_1

2oee__assembly_1__model_1 | I(q)

2oee__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)