SAXSdb — 2oya

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Macrophage receptor MARCO

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	SULFATE ION × 2 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	SULFATE ION × 1 water × 1	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 2	SULFATE ION × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MARCO_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–102； UniProt 421–518 Author chain B； PDBConstruct 5–102； UniProt 421–518

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2oya
Deposition date deposition_date	2007-02-21
Structure title title	Crystal structure analysis of the dimeric form of the SRCR domain of mouse MARCO
Keywords keywords	;Extracellular matrix, Scavenger receptor cysteine-rich (SRCR), macrophage receptor, ligand binding, basic cluster, acidic cluster, sulfate binding, dimer, LIGAND BINDING PROTEIN ;; LIGAND BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2oya__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2oya__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2oya__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	14.93 Å
Rg (electron density)	13.89 Å
Total Rg	15.03 Å
Atom count	797
Residues	102
Excluded volume	13518 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2oya__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2oya__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2oya__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Macrophage receptor MARCO
Molecular weight formula_weight	11337.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1843

APLAQRVRIMGGTNRGRAEVYYNNEWGTICDDDWDNNDATVFCRMLGYSRGRALSSYGGGSGNIWLDNVNCRGTENSLWDCSKNSWGNHNCVHNEDAGVECS

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	192

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2oyaa1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.170 — SRCR-like
Superfamily Superfamily superfamily	d.170.1 — SRCR-like
Family Family family	d.170.1.0 — automated matches

Domain ID domain_id	d2oyaa2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2oyab1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.170 — SRCR-like
Superfamily Superfamily superfamily	d.170.1 — SRCR-like
Family Family family	d.170.1.0 — automated matches

Domain ID domain_id	d2oyab2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (2 domains)

Domain ID domain_id	2oyaA00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	250 — Mac-2 Binding Protein
Homologous superfamily homologous superfamily	10 — SRCR-like domain

Domain ID domain_id	2oyaB00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	250 — Mac-2 Binding Protein
Homologous superfamily homologous superfamily	10 — SRCR-like domain

▶

Unit-cell length a length_a	31.087 Å
Unit-cell length b length_b	36.553 Å
Unit-cell length c length_c	44.605 Å
Unit-cell angle α angle_alpha	116.30 °
Unit-cell angle β angle_beta	90.35 °
Unit-cell angle γ angle_gamma	96.41 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.770 Å
Low-resolution limit resolution_low	14.912 Å
R factor r_factor	0.1540
R_work r_work	0.1500
R_free r_free	0.1910

Crystal structure analysis of the dimeric form of the SRCR domain of mouse MARCO

1. Protein Identity and Related Structures Protein Identity & Related Structures

Macrophage receptor MARCO

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2oya__assembly_2__model_1

2oya__assembly_2__model_1 | I(q)

2oya__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Crystal structure analysis of the dimeric form of the SRCR domain of mouse MARCO

1. Protein Identity and Related Structures Protein Identity & Related Structures

Macrophage receptor MARCO

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2oya__assembly_2__model_1

2oya__assembly_2__model_1 | I(q)

2oya__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (1)