SAXSdb — 2p0t

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

UPF0307 protein PSPTO_4464

Pseudomonas syringae pv. tomato

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	FORMIC ACID × 3 DI(HYDROXYETHYL)ETHER × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Y4464_PSESM
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–176； UniProt 1–173

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2p0t
Deposition date deposition_date	2007-03-01
Structure title title	Structural Genomics, the crystal structure of a conserved putative protein from Pseudomonas syringae pv. tomato str. DC3000
Keywords keywords	;APC85033, conserved putative protein, Pseudomonas syringae pv. tomato str. DC3000, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, UNKNOWN FUNCTION ;; STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2p0t__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2p0t__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2p0t__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.59 Å
Rg (electron density)	23.32 Å
Total Rg	24.00 Å
Atom count	1232
Residues	147
Excluded volume	21919 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2p0t__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	UPF0307 protein PSPTO_4464
Molecular weight formula_weight	20540.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1250

SNAMVDSYDDSLDGEKSKTQVKRELHALVDLGERLTTLKADVLAKLPLTDALRKALAEAPKHTANIARKRHILFIGKLMRDQDQEAILVLLDQLDASTRQYNERFHNLERWRDRLIAGDDADLEKFVIEYPDADRQQLRSLIRQAQHEVARNKPPATSRKIFKYIRELDELQRGLR

Source Source

Source organism organism	Pseudomonas syringae pv. tomato
NCBI taxonomy ID ncbi_taxonomy_id	223283
Host organism host_organism	Escherichia coli BL21

Entity 2 Entity 2 non-polymer

Description description	FORMIC ACID
Molecular weight formula_weight	46.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 non-polymer

Description description	DI(HYDROXYETHYL)ETHER
Molecular weight formula_weight	106.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	18

▼

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d2p0ta1
Class class	a — All alpha proteins
Fold Fold fold	a.290 — PSPTO4464-like
Superfamily Superfamily superfamily	a.290.1 — PSPTO4464-like
Family Family family	a.290.1.1 — PSPTO4464-like

CATH v4.4 (2 domains)

Domain ID domain_id	2p0tA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	60 — Diphtheria Toxin Repressor; domain 2
Homologous superfamily homologous superfamily	30 — PSPTO4464-like domains

Domain ID domain_id	2p0tA02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	60 — Diphtheria Toxin Repressor; domain 2
Homologous superfamily homologous superfamily	30 — PSPTO4464-like domains

▶

Unit-cell length a length_a	47.848 Å
Unit-cell length b length_b	47.848 Å
Unit-cell length c length_c	127.822 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 31 2 1
Space-group number int_tables_number	152
Crystal system crystal_system	—

Resolution resolution	2.190 Å
Low-resolution limit resolution_low	41.450 Å
R factor r_factor	0.2213
R_work r_work	0.2161
R_free r_free	0.2848

Structural Genomics, the crystal structure of a conserved putative protein from Pseudomonas syringae pv. tomato str. DC3000

1. Protein Identity and Related Structures Protein Identity & Related Structures

UPF0307 protein PSPTO_4464

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2p0t__assembly_1__model_1

2p0t__assembly_1__model_1 | I(q)

2p0t__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (1 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Structural Genomics, the crystal structure of a conserved putative protein from Pseudomonas syringae pv. tomato str. DC3000

1. Protein Identity and Related Structures Protein Identity & Related Structures

UPF0307 protein PSPTO_4464

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2p0t__assembly_1__model_1

2p0t__assembly_1__model_1 | I(q)

2p0t__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (1 domains)

CATH v4.4 (2 domains)

7. Citations (1)