SAXSdb — 2p1l

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Apoptosis regulator Bcl-X

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Beclin 1 × 1 （Q14457） water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Beclin 1 × 1 （Q14457） water × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Beclin 1 × 1 （Q14457） water × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Beclin 1 × 1 （Q14457） water × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 16	Beclin 1 × 8 （Q14457） water × 8	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 4	Beclin 1 × 2 （Q14457） water × 2	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 4	Beclin 1 × 2 （Q14457） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BCLX_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–26； UniProt 1–26 Author chain A； PDBConstruct 27–153； UniProt 83–209 Author chain C； PDBConstruct 1–26； UniProt 1–26 Author chain C； PDBConstruct 27–153； UniProt 83–209 Author chain E； PDBConstruct 1–26； UniProt 1–26 Author chain E； PDBConstruct 27–153； UniProt 83–209 Author chain G； PDBConstruct 1–26； UniProt 1–26 Author chain G； PDBConstruct 27–153； UniProt 83–209

Beclin 1

Homo sapiens

UniProt Q14457

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Apoptosis regulator Bcl-X × 1 （Q07817） water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Apoptosis regulator Bcl-X × 1 （Q07817） water × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Apoptosis regulator Bcl-X × 1 （Q07817） water × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Apoptosis regulator Bcl-X × 1 （Q07817） water × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 16	Apoptosis regulator Bcl-X × 8 （Q07817） water × 8	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 4	Apoptosis regulator Bcl-X × 2 （Q07817） water × 2	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 4	Apoptosis regulator Bcl-X × 2 （Q07817） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BCN1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 3–31； UniProt 107–135 Author chain D； PDBConstruct 3–31； UniProt 107–135 Author chain F； PDBConstruct 3–31； UniProt 107–135 Author chain H； PDBConstruct 3–31； UniProt 107–135

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2p1l
Deposition date deposition_date	2007-03-05
Structure title title	Structure of the Bcl-XL:Beclin 1 complex
Keywords keywords	Apoptosis; autophagy; beclin; BH3 domain; Bcl, APOPTOSIS; APOPTOSIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2p1l__assembly_5__model_1

Assembly 5 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2p1l__assembly_5__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2p1l__assembly_5__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	45.12 Å
Rg (electron density)	44.40 Å
Total Rg	44.80 Å
Atom count	10568
Residues	1320
Excluded volume	186290 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2p1l__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2p1l__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2p1l__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2p1l__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`2p1l__assembly_5__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`2p1l__assembly_6__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`2p1l__assembly_7__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Apoptosis regulator Bcl-X
Molecular weight formula_weight	17506.5 kDa
Mutation mutation	Loop 27-82 deletion mutant
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G
Atom count atom_count	5300

MSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQER

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Beclin 1
Molecular weight formula_weight	3381.8 kDa
Mutation mutation	BH3 domain (residues 107-135)
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H

GSGTMENLSRRLKVTGDLFDIMSGQTDVDHP

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	16

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2p1la_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.1 — Toxins' membrane translocation domains
Superfamily Superfamily superfamily	f.1.4 — Bcl-2 inhibitors of programmed cell death
Family Family family	f.1.4.1 — Bcl-2 inhibitors of programmed cell death

Domain ID domain_id	d2p1lc_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.1 — Toxins' membrane translocation domains
Superfamily Superfamily superfamily	f.1.4 — Bcl-2 inhibitors of programmed cell death
Family Family family	f.1.4.1 — Bcl-2 inhibitors of programmed cell death

Domain ID domain_id	d2p1le_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.1 — Toxins' membrane translocation domains
Superfamily Superfamily superfamily	f.1.4 — Bcl-2 inhibitors of programmed cell death
Family Family family	f.1.4.1 — Bcl-2 inhibitors of programmed cell death

Domain ID domain_id	d2p1lg_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.1 — Toxins' membrane translocation domains
Superfamily Superfamily superfamily	f.1.4 — Bcl-2 inhibitors of programmed cell death
Family Family family	f.1.4.1 — Bcl-2 inhibitors of programmed cell death

CATH v4.4 (4 domains)

Domain ID domain_id	2p1lA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	437 — Apoptosis Regulator Bcl-x
Homologous superfamily homologous superfamily	10 — Blc2-like

Domain ID domain_id	2p1lC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	437 — Apoptosis Regulator Bcl-x
Homologous superfamily homologous superfamily	10 — Blc2-like

Domain ID domain_id	2p1lE00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	437 — Apoptosis Regulator Bcl-x
Homologous superfamily homologous superfamily	10 — Blc2-like

Domain ID domain_id	2p1lG00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	437 — Apoptosis Regulator Bcl-x
Homologous superfamily homologous superfamily	10 — Blc2-like

▶

Unit-cell length a length_a	107.940 Å
Unit-cell length b length_b	110.590 Å
Unit-cell length c length_c	100.520 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	29.730 Å
R factor r_factor	0.2250
R_work r_work	0.2260
R_free r_free	0.2620

Structure of the Bcl-XL:Beclin 1 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Apoptosis regulator Bcl-X

State in the Current Structure

Other States of the Same Protein in the Database

Beclin 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2p1l__assembly_5__model_1

2p1l__assembly_5__model_1 | I(q)

2p1l__assembly_5__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Structure of the Bcl-XL:Beclin 1 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Apoptosis regulator Bcl-X

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Beclin 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2p1l__assembly_5__model_1

2p1l__assembly_5__model_1 | I(q)

2p1l__assembly_5__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)