2pmz

Archaeal RNA polymerase from Sulfolobus solfataricus

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase subunit A

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 11	;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPOA1_SULSO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–880； UniProt 1–880 Author chain Q； PDBConstruct 1–880； UniProt 1–880

;DNA-directed RNA polymerase subunit A" ;

OrganismNot specified

UniProt P58192

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPOA2_SULSO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–392； UniProt 1–392 Author chain G； PDBConstruct 1–392； UniProt 1–392

DNA-directed RNA polymerase subunit B

OrganismNot specified

UniProt Q980R1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q980R1_SULSO
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 479–1124； UniProt 4–649 Author chain R； PDBConstruct 479–1124； UniProt 4–649

DNA-directed RNA polymerase subunit D

OrganismNot specified

UniProt P95989

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPOD_SULSO
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–265； UniProt 1–265 Author chain S； PDBConstruct 1–265； UniProt 1–265

DNA-directed RNA polymerase subunit E

OrganismNot specified

UniProt Q980A3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q980A3_SULSO
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–180； UniProt 1–180 Author chain T； PDBConstruct 1–180； UniProt 1–180

DNA-directed RNA polymerase subunit F

OrganismNot specified

UniProt Q9UXD9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9UXD9_SULSO
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–113； UniProt 1–113 Author chain U； PDBConstruct 1–113； UniProt 1–113

DNA-directed RNA polymerase subunit H

OrganismNot specified

UniProt Q980Q9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPOH_SULSO
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–84； UniProt 1–84 Author chain V； PDBConstruct 1–84； UniProt 1–84

DNA-directed RNA polymerase subunit K

OrganismNot specified

UniProt Q97ZJ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPOK_SULSO
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain K； PDBConstruct 1–95； UniProt 1–95 Author chain W； PDBConstruct 1–95； UniProt 1–95

DNA-directed RNA polymerase subunit L

OrganismNot specified

UniProt Q980K0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPOL_SULSO
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain L； PDBConstruct 1–92； UniProt 1–92 Author chain X； PDBConstruct 1–92； UniProt 1–92

DNA-directed RNA polymerase subunit N

OrganismNot specified

UniProt Q980Z8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit P × 1 （Q97ZX7） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPON_SULSO
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain N； PDBConstruct 1–66； UniProt 1–66 Author chain Y； PDBConstruct 1–66； UniProt 1–66

DNA-directed RNA polymerase subunit P

OrganismNot specified

UniProt Q97ZX7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 11	DNA-directed RNA polymerase subunit A × 1 （Q980R2） ;DNA-directed RNA polymerase subunit A" ; × 1 （P58192） DNA-directed RNA polymerase subunit B × 1 （Q980R1） DNA-directed RNA polymerase subunit D × 1 （P95989） DNA-directed RNA polymerase subunit E × 1 （Q980A3） DNA-directed RNA polymerase subunit F × 1 （Q9UXD9） DNA-directed RNA polymerase subunit H × 1 （Q980Q9） DNA-directed RNA polymerase subunit K × 1 （Q97ZJ9） DNA-directed RNA polymerase subunit L × 1 （Q980K0） DNA-directed RNA polymerase subunit N × 1 （Q980Z8） ZINC ION × 4 MAGNESIUM ION × 1 FE3-S4 CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPOP_SULSO
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain P； PDBConstruct 1–48； UniProt 1–48 Author chain Z； PDBConstruct 1–48； UniProt 1–48

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2pmz
Deposition date deposition_date	2007-04-23
Structure title title	Archaeal RNA polymerase from Sulfolobus solfataricus
Keywords keywords	4Fe-4S cluster binding motif, TRANSLATION, TRANSFERASE; TRANSLATION, TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2pmz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2pmz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2pmz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	47.38 Å
Rg (electron density)	47.10 Å
Total Rg	47.45 Å
Atom count	24061
Residues	3029
Excluded volume	432360 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2pmz__assembly_1__model_1`	undecameric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2pmz__assembly_2__model_1`	undecameric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Description description	DNA-directed RNA polymerase subunit A
Molecular weight formula_weight	99815.7 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,Q
Atom count atom_count	48122

MSEKNIKGIKFGILSPDEIRKMSVTAIITPDVYDEDGTPIEGSVMDPRLGVIEPGQKCPTCGNTLGNCPGHFGHIELVRPVIHVGLVKHIYEFLKATCRRCGRVKISEDEIEKYSRIYNAIKKRWPSAARRLTEYVKKTAMKAQVCPHCNEKQYKIKLEKPYNFYEERKEGVAKLTPSDIRERLEKIPDSDVEILGYDPTTSRPEWMILTVLPVPPITIRPSIMIESGIRAEDDLTHKLVDIVRINERLKESIDAGAPQLIIEDLWDLLQYHVATYFDNEIPGLPPSKHRSGRPLRTLAQRLKGKEGRFRGNLSGKRVDFSSRTVISPDPNISIDEVGVPEIIAKTLTVPERITPWNIEKLRQFVINGPDKWPGANYVIRPDGRRIDLRYVKDRKELASTLAPGYIIERHLIDGDIVLFNRQPSLHRISMMAHRVRVLKGLTFRLNLLVCPPYNADFDGDEMNLHVPQSEEAIAEAKEIMLVHKNIITPRYGGPIIGAAQDYISGAYLLTVKTTLLTKEEAQQILGVADVKIDLGEPAILAPREYYTGKQVISAFLPKDFNFHGQANVSSGPRLCKNEDCPHDSYVVIKNGILLEGVFDKKAIGNQQPESILHWLIKEYSDEYGKWLMDNLFRVFIRFVELQGFTMRLEDVSLGDDVKKEIYNEIDRAKVEVDNLIQKYKNGELEPIPGRTLEESLENYILDTLDKLRSTAGDIASKYLDPFNFAYVMARTGARGSVLNITQMAAMLGQQSVRGERIKRGYMTRTLPHFKPYDISPEARGFIYSSFRTGLKPTELFFHAAGGREGLVDTAVRTSQSGYMQRRLINALSDLRAEYDGTVRSLYGEVVQVAYGDDGVFPMYSAHGKTVDVNRIFERVVGWKA

Entity 2 Entity 2 polymer

Description description	;DNA-directed RNA polymerase subunit A" ;
Molecular weight formula_weight	43548.6 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G

MIDEKDKPYLEEKVKQASNILPQKIVDDLKNLILNKEIIVTRDEIDKIFDLAIKEYSEGLIAPGEAIGIVAAQSVGEPGTQMTLRTFHFAGIRELNVTLGLPRLIEIVDAKKVPSTPMMTIYLTDEYKRDRDKALEVARKLEYTKIENVVSSTSIDIASMSIILQLDNEMLKDKGVTVDDVKKAIGRLKLGDFMIEESEDSTLNINFANIDSIAALFKLRDKILNTKIKGIKGIKRAIVQKKGDEYIILTDGSNLSGVLSVKGVDVAKVETNNIREIEEVFGIEAAREIIIREISKVLAEQGLDVDIRHILLIADVMTRTGIVRQIGRHGVTGEKNSVLARAAFEVTVKHLLDAAARGDVEEFKGVVENIIIGHPIKLGTGMVELTMRPILR

Entity 3 Entity 3 polymer

Description description	DNA-directed RNA polymerase subunit B
Molecular weight formula_weight	126721.2 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,R

MASNLTIDERWRVIEAYFKSKGLVRQHLDSYNDFVRNKLQEIIDEQGEIPTEIPGLKVRLGKIRIGKPRVRESDRGEREISPMEARLRNLTYAAPLWLTMIPVENNIEAEPEEVYIGDLPIMLKSAIDPISQYTLDKLIEIGEDPKDPGGYFIVNGSERVIVTQEDLAPNRVLVDTGKTGSNITHTAKIISSTAGYRVPVTIERLKDGTFHVSFPAVPGKIPFVILMRALGILTDRDIVYAVSLDPEVQNELFPSLEQASSIANVDDALDFIGSRVAIGQKRENRIEKAQQIIDKYFLPHLGTSAEDRKKKAYYLAYAISKVIELYLGRREPDDKDHYANKRLRLAGDLFASLFRVAFKAFVKDLTYQLEKSKVRGRKLALKALVRPDIVTERIRHALATGNWVGGRTGVSQLLDRTNWLSMLSHLRRVISSLARGQPNFEARDLHGTQWGRMCPFETPEGPNSGLVKNLALMAQIAVGINERIVEKTLYEMGVVPVEEVIRRVTEGGEDQNEYLKWSKVILNGRLIGYYQDGGELANKIRERRRKGEISDEVNVGHIVTDFINEVHVNCDSGRVRRPLIIVSNGNPLVTIEDIEKLESGAITFDDLVRQGKIEYLDAEEEENAYVALEPNDLTPDHTHLEIWSPAILGITASIIPYPEHNQSPRNTYQSAMAKQALGLYAANYQLRTDTRAHLLHYPQRPLVQTRALDIIGYTNRPAGNNAILAVMSFTGYNMEDSIIMNRSSVERGMYRSTFFRLYSTEEVKYPGGQEDKIVMPEAGVRGYKGKEYYRLLEDNGVVSPEVEVKGGDVLIGKVSPPRFLQEFKELSPEQAKRDTSIVTRHGEMGIVDLVLITETAEGNKLVKVRVRDLRIPTIGDKFASRHGQKGVIGMLIPQVDMPYTVKGVVPDIILNPHALPSRMTLGQIMEGIAGKYAALSGNIVDATPFYKTPIEQLQNEILRYGYLPDATEVVYDGRTGQKIKSRIYFGVVYYQKLHHMVADKLHARARGPVQILTRQPTEGRAREGGLRFGEMERDCLIGFGTAMLLKDRLLDNSDRTMIYVCDQCGYIGWYDKNKNKYVCPIHGDKSNLFPVTVSYAFKLLIQELMSMIISPRLVLEDKVGLSGG

Entity 4 Entity 4 polymer

Description description	DNA-directed RNA polymerase subunit D
Molecular weight formula_weight	30330.2 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,S

MSINLLHKDDTRIDLVFEGYPLEFVNAIRRASMLYVPIMAVDDVYFIENNSPLYDEILAHRLALIPFMSEEALDTYRWPEECIECTENCEKCYTKIYIEAEAPNEPRMIYSKDIKSEDPSVVPISGDIPIVLLGTNQKISLEARLRLGYGKEHAKFIPVSLSVVRYYPKVEILANCEKAVNVCPEGVFELKDGKLSVKNELSCTLCEECLRYCNGSIRISFVEDKYILEIESVGSLKPERILLEAGKSIIRKIEELEKKLVEVVK

Entity 5 Entity 5 polymer

Description description	DNA-directed RNA polymerase subunit E
Molecular weight formula_weight	20354.7 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,T

MYKLIKARSIVRIPPNEFGKPLNEIALNELRQQYQEKILKDLGLVLAILNVKTSEEGILVFGDGATYHEVEFDMITYVPVVQEVVEGEVLQVDNYGIFVNLGPMDGLVHISQITDDTLKYDNVRGIIFGEKSKKVIQKGDKVRARVISVASTVTGRLPRIALTMRQPYLGKLEWITQTKK

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerase subunit F
Molecular weight formula_weight	12825.6 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,U

MSSVYIVEEHYIPYSVAKKLLTDVIRSGGSSNLLQRTYDYLNSVEKCDAESAQKVIEELSNIVSREDVRAILASICPTTSDEVRSILVMDTNKTYTSEDIQKIIDIIRKYIKS

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerase subunit H
Molecular weight formula_weight	9687.3 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,V

MRGSSNKKIDPRIHYLVPKHEVLNIDEAYKILKELGIRPEQLPWIRASDPVARSINAKPGDIIRIIRKSQLYGEVVSYRYVISG

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerase subunit K
Molecular weight formula_weight	10871.7 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,W

MGLERDEILSQDLHFNEVFISLWQNRLTRYEIARVISARALQLAMGAPALIDINNLSSTDVISIAEEEFRRGVLPITIRRRLPNGKIILLSLRKS

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase subunit L
Molecular weight formula_weight	10298.8 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,X

MEIRILKSESNYLELEIEGEDHTLGNLIAGTLRRISGVSFASYYQPHPLSDKIIVKILTDGSITPKDALLKAIENIRGMTSHYIDEIKGLTK

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerase subunit N
Molecular weight formula_weight	7602.0 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,Y

MLIPIRCFTCGSLIADKWQSFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHVDIINEVIHYTRPI

Entity 11 Entity 11 polymer

Description description	DNA-directed RNA polymerase subunit P
Molecular weight formula_weight	5607.0 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,Z

MAVYRCGKCWKTFTDEQLKVLPGVRCPYCGYKIIFMVRKPTIKIVKAI

Entity 12 Entity 12 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 13 Entity 13 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 14 Entity 14 non-polymer

Description description	FE3-S4 CLUSTER
Molecular weight formula_weight	295.8 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 52 domains

CATH v4.4 (52 domains)

Domain ID domain_id	2pmzA02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	40 — Barwin-like endoglucanases
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2pmzA03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1490 — Dna Ligase; domain 1
Homologous superfamily homologous superfamily	180 — RNA polymerase ii

Domain ID domain_id	2pmzA04
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	1950 —

Domain ID domain_id	2pmzA05
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	320 — Dihydrolipoamide Transferase
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	2pmzA06
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	2940 —

Domain ID domain_id	2pmzA07
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	132 — Topoisomerase I; Chain A, domain 4
Homologous superfamily homologous superfamily	30 — RNA polymerase Rpb1 funnel domain

Domain ID domain_id	2pmzA08
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	2940 —

Domain ID domain_id	2pmzA09
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	50 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	80 —

Domain ID domain_id	2pmzB04
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1110 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3
Homologous superfamily homologous superfamily	10 — RNA polymerase Rpb2, domain 2

Domain ID domain_id	2pmzB05
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1070 — Hypothetical Protein Ta0175; Chain: A, domain 2
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2pmzB06
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	270 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; Domain 6
Homologous superfamily homologous superfamily	10 — DNA-directed RNA polymerase, subunit 2, domain 6

Domain ID domain_id	2pmzB07
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	150 — RNA polymerase II, Rpb2 subunit, wall domain

Domain ID domain_id	2pmzB08
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1800 — DCoH-like
Homologous superfamily homologous superfamily	10 — RNA polymerase alpha subunit dimerisation domain

Domain ID domain_id	2pmzC02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	150 — DNA polymerase; domain 1
Homologous superfamily homologous superfamily	390 —

Domain ID domain_id	2pmzD01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

Domain ID domain_id	2pmzD02
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	120 — RNA Polymerase Alpha Subunit; Chain A, domain 2
Homologous superfamily homologous superfamily	12 — DNA-directed RNA polymerase, insert domain

Domain ID domain_id	2pmzD03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2pmzE01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1490 — Dna Ligase; domain 1
Homologous superfamily homologous superfamily	120 — RNA polymerase Rpb7-like, N-terminal domain

Domain ID domain_id	2pmzE02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	2pmzF01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	930 —

Domain ID domain_id	2pmzF02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	150 — DNA polymerase; domain 1
Homologous superfamily homologous superfamily	80 — HRDC domain

Domain ID domain_id	2pmzG02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	150 — DNA polymerase; domain 1
Homologous superfamily homologous superfamily	390 —

Domain ID domain_id	2pmzH00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	940 — Eukaryotic RPB6 RNA polymerase subunit
Homologous superfamily homologous superfamily	20 — RPB5-like RNA polymerase subunit

Domain ID domain_id	2pmzK00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	940 — Eukaryotic RPB6 RNA polymerase subunit
Homologous superfamily homologous superfamily	10 — RNA polymerase subunit, RPB6/omega

Domain ID domain_id	2pmzL00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

Domain ID domain_id	2pmzN00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	60 — Homeodomain-like

Domain ID domain_id	2pmzP00
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	28 — Rubrerythrin, domain 2
Homologous superfamily homologous superfamily	30 — RNA polymerase ii, chain L

Domain ID domain_id	2pmzQ02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	40 — Barwin-like endoglucanases
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2pmzQ03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1490 — Dna Ligase; domain 1
Homologous superfamily homologous superfamily	180 — RNA polymerase ii

Domain ID domain_id	2pmzQ04
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	1950 —

Domain ID domain_id	2pmzQ05
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	320 — Dihydrolipoamide Transferase
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	2pmzQ06
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	2940 —

Domain ID domain_id	2pmzQ07
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	132 — Topoisomerase I; Chain A, domain 4
Homologous superfamily homologous superfamily	30 — RNA polymerase Rpb1 funnel domain

Domain ID domain_id	2pmzQ08
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	2940 —

Domain ID domain_id	2pmzQ09
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	50 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	80 —

Domain ID domain_id	2pmzR04
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1110 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3
Homologous superfamily homologous superfamily	10 — RNA polymerase Rpb2, domain 2

Domain ID domain_id	2pmzR05
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1070 — Hypothetical Protein Ta0175; Chain: A, domain 2
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2pmzR06
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	270 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; Domain 6
Homologous superfamily homologous superfamily	10 — DNA-directed RNA polymerase, subunit 2, domain 6

Domain ID domain_id	2pmzR07
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	150 — RNA polymerase II, Rpb2 subunit, wall domain

Domain ID domain_id	2pmzR08
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1800 — DCoH-like
Homologous superfamily homologous superfamily	10 — RNA polymerase alpha subunit dimerisation domain

Domain ID domain_id	2pmzS01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

Domain ID domain_id	2pmzS02
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	120 — RNA Polymerase Alpha Subunit; Chain A, domain 2
Homologous superfamily homologous superfamily	12 — DNA-directed RNA polymerase, insert domain

Domain ID domain_id	2pmzS03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2pmzT01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1490 — Dna Ligase; domain 1
Homologous superfamily homologous superfamily	120 — RNA polymerase Rpb7-like, N-terminal domain

Domain ID domain_id	2pmzT02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	2pmzU01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	930 —

Domain ID domain_id	2pmzU02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	150 — DNA polymerase; domain 1
Homologous superfamily homologous superfamily	80 — HRDC domain

Domain ID domain_id	2pmzV00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	940 — Eukaryotic RPB6 RNA polymerase subunit
Homologous superfamily homologous superfamily	20 — RPB5-like RNA polymerase subunit

Domain ID domain_id	2pmzW00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	940 — Eukaryotic RPB6 RNA polymerase subunit
Homologous superfamily homologous superfamily	10 — RNA polymerase subunit, RPB6/omega

Domain ID domain_id	2pmzX00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

Domain ID domain_id	2pmzY00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	60 — Homeodomain-like

Domain ID domain_id	2pmzZ00
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	28 — Rubrerythrin, domain 2
Homologous superfamily homologous superfamily	30 — RNA polymerase ii, chain L

▶

Unit-cell length a length_a	125.820 Å
Unit-cell length b length_b	201.235 Å
Unit-cell length c length_c	196.050 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	100.92 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.400 Å
Low-resolution limit resolution_low	39.790 Å
R factor r_factor	0.2740
R_work r_work	0.2739
R_free r_free	0.3430

Archaeal RNA polymerase from Sulfolobus solfataricus

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase subunit A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;DNA-directed RNA polymerase subunit A" ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit D

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit K

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit N

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer