SAXSdb — 2pxy

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

T cell receptor alpha chain

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain A； UniProt 21–112	Not recorded	T cell receptor beta chain × 1 （A2NTY6） H-2 class II histocompatibility antigen, A-U alpha chain × 1 （P14438） H-2 class II histocompatibility antigen, A-U beta chain × 1 （P06344） Myelin basic protein (MBP)-peptide × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7；295 K；0.2M Potassium sodium tartrate tetrahydrate, 0.1M succinic acid (pH7.0), 16% polyethylene glycol 3350, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.23 Å R-free 0.253

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2PXY	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2Z31 Crystal structure of immune receptor complex Deposited 2007-05-30	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 21–112（92 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；295 K；0.2M patassium sodium tartrate tetrahydrate, 0.1M succinic acid, 16% polyethylene glycol 3350, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.70 Å R-free 0.287
2Z35 Crystal structure of immune receptor Deposited 2007-06-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 21–112（92 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；295 K；0.8M mono-sodium dihydrogen phosphate, 0.8M mono-potassium dihydrogen phosphate and 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.20 Å R-free 0.285

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q5R1F5_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–94； UniProt 21–112

T cell receptor beta chain

Mus musculus

UniProt A2NTY6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain B； UniProt 32–144	Mutation：G17E,H47Y,I75T,L78S	T cell receptor alpha chain × 1 （Q5R1F5） H-2 class II histocompatibility antigen, A-U alpha chain × 1 （P14438） H-2 class II histocompatibility antigen, A-U beta chain × 1 （P06344） Myelin basic protein (MBP)-peptide × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7；295 K；0.2M Potassium sodium tartrate tetrahydrate, 0.1M succinic acid (pH7.0), 16% polyethylene glycol 3350, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.23 Å R-free 0.253

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2PXY	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2E7L Structure of a high-affinity mutant of the 2C TCR in complex with Ld/QL9 Deposited 2007-01-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 30–144（115 aa） Fragment：UNP RESIDUES 30-144	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；298 K；0.2M ammonium phosphate, 20% PEG 3350, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.50 Å R-free 0.246
2E7L Structure of a high-affinity mutant of the 2C TCR in complex with Ld/QL9 Deposited 2007-01-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 30–144（115 aa） Fragment：UNP RESIDUES 30-144	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；298 K；0.2M ammonium phosphate, 20% PEG 3350, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.50 Å R-free 0.246
2OI9 Structure of the 2C/Ld/QL9 allogeneic complex Deposited 2007-01-10	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 30–144（115 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；298 K；0.9M sodium dihydrogen phosphate, 0.01M di-potassium hydrogen phosphate, pH 7.2, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.35 Å R-free 0.226
2Z31 Crystal structure of immune receptor complex Deposited 2007-05-30	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 32–144（113 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；295 K；0.2M patassium sodium tartrate tetrahydrate, 0.1M succinic acid, 16% polyethylene glycol 3350, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.70 Å R-free 0.287
2Z35 Crystal structure of immune receptor Deposited 2007-06-01	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 32–144（113 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；295 K；0.8M mono-sodium dihydrogen phosphate, 0.8M mono-potassium dihydrogen phosphate and 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.20 Å R-free 0.285
3MC0 Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a Mouse T-cell Receptor beta Chain Deposited 2010-03-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 31–144（114 aa） Fragment：unp residues 31-144	Not recorded	ACT ACETATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；sodium acetate 1.4 M protein concentration 7.5 mg/ml, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.211
3MC0 Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a Mouse T-cell Receptor beta Chain Deposited 2010-03-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 31–144（114 aa） Fragment：unp residues 31-144	Not recorded	ACT ACETATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；sodium acetate 1.4 M protein concentration 7.5 mg/ml, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.211
3OWE Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain Deposited 2010-09-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 29–144（116 aa） Fragment：VARIABLE DOMAIN	Mutation：G17E, A52V, S54N, K66E, Q72H, E80V, L81S, T87S, G96V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2 M sodium citrate, 30% iso-propanol and 0.1 M sodium cacodylate, Protein concentration: 3.25 mg/ml in the drop, VAPOR DIFFUSION, HANGING DROP, temperature 298K, pH 6.5	Resolution 2.60 Å R-free 0.261
3OWE Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain Deposited 2010-09-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 29–144（116 aa） Fragment：VARIABLE DOMAIN	Mutation：G17E, A52V, S54N, K66E, Q72H, E80V, L81S, T87S, G96V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2 M sodium citrate, 30% iso-propanol and 0.1 M sodium cacodylate, Protein concentration: 3.25 mg/ml in the drop, VAPOR DIFFUSION, HANGING DROP, temperature 298K, pH 6.5	Resolution 2.60 Å R-free 0.261
3OWE Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain Deposited 2010-09-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 29–144（116 aa） Fragment：VARIABLE DOMAIN	Mutation：G17E, A52V, S54N, K66E, Q72H, E80V, L81S, T87S, G96V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2 M sodium citrate, 30% iso-propanol and 0.1 M sodium cacodylate, Protein concentration: 3.25 mg/ml in the drop, VAPOR DIFFUSION, HANGING DROP, temperature 298K, pH 6.5	Resolution 2.60 Å R-free 0.261
3OWE Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain Deposited 2010-09-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 29–144（116 aa） Fragment：VARIABLE DOMAIN	Mutation：G17E, A52V, S54N, K66E, Q72H, E80V, L81S, T87S, G96V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2 M sodium citrate, 30% iso-propanol and 0.1 M sodium cacodylate, Protein concentration: 3.25 mg/ml in the drop, VAPOR DIFFUSION, HANGING DROP, temperature 298K, pH 6.5	Resolution 2.60 Å R-free 0.261
3OWE Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain Deposited 2010-09-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 29–144（116 aa） Fragment：VARIABLE DOMAIN	Mutation：G17E, A52V, S54N, K66E, Q72H, E80V, L81S, T87S, G96V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2 M sodium citrate, 30% iso-propanol and 0.1 M sodium cacodylate, Protein concentration: 3.25 mg/ml in the drop, VAPOR DIFFUSION, HANGING DROP, temperature 298K, pH 6.5	Resolution 2.60 Å R-free 0.261
3OWE Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain Deposited 2010-09-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 29–144（116 aa） Fragment：VARIABLE DOMAIN	Mutation：G17E, A52V, S54N, K66E, Q72H, E80V, L81S, T87S, G96V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2 M sodium citrate, 30% iso-propanol and 0.1 M sodium cacodylate, Protein concentration: 3.25 mg/ml in the drop, VAPOR DIFFUSION, HANGING DROP, temperature 298K, pH 6.5	Resolution 2.60 Å R-free 0.261
3OWE Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain Deposited 2010-09-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain M 29–144（116 aa） Fragment：VARIABLE DOMAIN	Mutation：G17E, A52V, S54N, K66E, Q72H, E80V, L81S, T87S, G96V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2 M sodium citrate, 30% iso-propanol and 0.1 M sodium cacodylate, Protein concentration: 3.25 mg/ml in the drop, VAPOR DIFFUSION, HANGING DROP, temperature 298K, pH 6.5	Resolution 2.60 Å R-free 0.261
3OWE Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain Deposited 2010-09-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain O 29–144（116 aa） Fragment：VARIABLE DOMAIN	Mutation：G17E, A52V, S54N, K66E, Q72H, E80V, L81S, T87S, G96V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2 M sodium citrate, 30% iso-propanol and 0.1 M sodium cacodylate, Protein concentration: 3.25 mg/ml in the drop, VAPOR DIFFUSION, HANGING DROP, temperature 298K, pH 6.5	Resolution 2.60 Å R-free 0.261
6MIV Crystal structure of the mCD1d/xxq (JJ300)/iNKTCR ternary complex Deposited 2018-09-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 29–123（95 aa）	Not recorded	NA SODIUM ION × 3 GOL GLYCEROL × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 JU1 N-[(2S,3S,4R)-1-({4-O-[(4-tert-butylphenyl)methyl]-alpha-D-galactopyranosyl}oxy)-3,4-dihydroxyoctadecan-2-yl]hexacosanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；295 K；0.1 m sodium malonate pH 4.0, 12% PEG 3350	Resolution 2.05 Å R-free 0.219
6MIY Crystal structure of the mCD1d/xxa (JJ239)/iNKTCR ternary complex Deposited 2018-09-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 29–123（95 aa）	Not recorded	NA SODIUM ION × 2 CL CHLORIDE ION × 1 JTV N-{(2S,3S,4R)-1-[(4-O-benzyl-alpha-D-galactopyranosyl)oxy]-3,4-dihydroxyoctadecan-2-yl}hexacosanamide × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.2 m ammonium tartrate dibasic, 20% PEG 4000	Resolution 2.75 Å R-free 0.247
6MIY Crystal structure of the mCD1d/xxa (JJ239)/iNKTCR ternary complex Deposited 2018-09-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 29–123（95 aa）	Not recorded	NA SODIUM ION × 2 JTV N-{(2S,3S,4R)-1-[(4-O-benzyl-alpha-D-galactopyranosyl)oxy]-3,4-dihydroxyoctadecan-2-yl}hexacosanamide × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.2 m ammonium tartrate dibasic, 20% PEG 4000	Resolution 2.75 Å R-free 0.247
6MJ4 Crystal structure of MCD1D/INKTCR TERNARY COMPLEX bound to glycolipid (XXW) Deposited 2018-09-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 29–123（95 aa）	Not recorded	GOL GLYCEROL × 6 NA SODIUM ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 JTG N-[(2S,3S,4R)-3,4-dihydroxy-1-{[4-O-(prop-2-en-1-yl)-alpha-D-galactopyranosyl]oxy}octadecan-2-yl]hexacosanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.1 m sodium malonate pH 4.0, 12% PEG 3350	Resolution 2.00 Å R-free 0.214
6MJ6 Crystal structure of the mCD1d/xxx (JJ166) /iNKTCR ternary complex Deposited 2018-09-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 29–123（95 aa）	Not recorded	GOL GLYCEROL × 7 NA SODIUM ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 JTM N-[(2S,3S,4R)-1-({4-O-[(4-chlorophenyl)methyl]-alpha-D-galactopyranosyl}oxy)-3,4-dihydroxyoctadecan-2-yl]hexacosanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.1 m sodium malonate pH 4.0, 12% PEG 3350	Resolution 2.45 Å R-free 0.234
6MJA Crystal structure of the mCD1d/xxo (JJ294) /iNKTCR ternary complex Deposited 2018-09-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 29–123（95 aa）	Not recorded	NA SODIUM ION × 2 GOL GLYCEROL × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 JTJ N-[(2S,3S,4R)-3,4-dihydroxy-1-({4-O-[(4-methylphenyl)methyl]-alpha-D-galactopyranosyl}oxy)octadecan-2-yl]hexacosanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.2 m ammonium tartrate dibasic, 20% PEG 4000	Resolution 2.35 Å R-free 0.237
6MJI Crystal structure of the mCD1d/xxs (JJ304) /iNKTCR ternary complex Deposited 2018-09-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 29–123（95 aa）	Not recorded	NA SODIUM ION × 2 GOL GLYCEROL × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 JTD N-[(2S,3S,4R)-1-{[4-O-(cyclopropylmethyl)-alpha-D-galactopyranosyl]oxy}-3,4-dihydroxyoctadecan-2-yl]hexacosanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.1 m sodium malonate pH 4.0, 12% PEG 3350	Resolution 2.30 Å R-free 0.227
6MJJ Crystal structure of the mCD1d/xxm (JJ290) /iNKTCR ternary complex Deposited 2018-09-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 29–123（95 aa）	Not recorded	GOL GLYCEROL × 10 NA SODIUM ION × 9 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 JU4 N-[(2S,3S,4R)-1-({4-O-[(3,4-dichlorophenyl)methyl]-alpha-D-galactopyranosyl}oxy)-3,4-dihydroxyoctadecan-2-yl]hexacosanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.1 m sodium malonate pH 4.0, 12% PEG 3350	Resolution 1.93 Å R-free 0.216
6MJQ Crystal structure of the mCD1d/xxp (JJ295) /iNKTCR ternary complex Deposited 2018-09-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 29–123（95 aa）	Not recorded	GOL GLYCEROL × 1 NA SODIUM ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 JUD N-{(2S,3S,4R)-3,4-dihydroxy-1-[(4-O-{[4-(trifluoromethyl)phenyl]methyl}-alpha-D-galactopyranosyl)oxy]octadecan-2-yl}hexacosanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.1 m sodium malonate pH 4.0, 12% PEG 3350	Resolution 3.00 Å R-free 0.258
6MJQ Crystal structure of the mCD1d/xxp (JJ295) /iNKTCR ternary complex Deposited 2018-09-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 29–123（95 aa）	Not recorded	GOL GLYCEROL × 2 NA SODIUM ION × 2 JUD N-{(2S,3S,4R)-3,4-dihydroxy-1-[(4-O-{[4-(trifluoromethyl)phenyl]methyl}-alpha-D-galactopyranosyl)oxy]octadecan-2-yl}hexacosanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.1 m sodium malonate pH 4.0, 12% PEG 3350	Resolution 3.00 Å R-free 0.258
8T4Z T-cell receptor and lipid complex structure Deposited 2023-06-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 29–123（95 aa）	Not recorded	Y73 N-[(2R,3R,4E)-1,3-dihydroxyoctadec-4-en-2-yl]tetracosanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；277 K；18-20% PEG3350, 8% Tacsimate pH 5.0	Resolution 2.69 Å R-free 0.265

15 other PDB entries and 26 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A2NTY6_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–111； UniProt 32–144

H-2 class II histocompatibility antigen, A-U alpha chain

Mus musculus

UniProt P14438

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain C； UniProt 1–178	Fragment：extracellular alpha-1, extracellular alpha-2	T cell receptor alpha chain × 1 （Q5R1F5） T cell receptor beta chain × 1 （A2NTY6） H-2 class II histocompatibility antigen, A-U beta chain × 1 （P06344） Myelin basic protein (MBP)-peptide × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7；295 K；0.2M Potassium sodium tartrate tetrahydrate, 0.1M succinic acid (pH7.0), 16% polyethylene glycol 3350, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.23 Å R-free 0.253

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2PXY	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1K2D Crystal structure of the autoimmune MHC class II I-Au complexed with myelin basic protein 1-11 at 2.2A Deposited 2001-09-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–179（179 aa） Fragment：EXTRACELLULAR ALPHA-1 AND ALPHA-2 DOMAINS	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；296 K；MPEG 5000, sodium chloride, citrate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 296K	Resolution 2.20 Å R-free 0.276
1U3H Crystal structure of mouse TCR 172.10 complexed with MHC class II I-Au molecule at 2.4 A Deposited 2004-07-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–179（179 aa） Fragment：extracellular alpha-1, extracellular alpha-2	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；291 K；21% PEG 3350, 0.1M Hepes and 0.2M LiSO4, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.42 Å R-free 0.274
1U3H Crystal structure of mouse TCR 172.10 complexed with MHC class II I-Au molecule at 2.4 A Deposited 2004-07-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain G 1–179（179 aa） Fragment：extracellular alpha-1, extracellular alpha-2	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；291 K；21% PEG 3350, 0.1M Hepes and 0.2M LiSO4, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.42 Å R-free 0.274
2P24 I-Au/MBP125-135 Deposited 2007-03-06	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–190（190 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291.15 K；0.1 M NaOAc, 25% (w/v) PEG 1000, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 291.15K	Resolution 2.15 Å R-free 0.260
2Z31 Crystal structure of immune receptor complex Deposited 2007-05-30	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–178（178 aa） Fragment：extracellular alpha-1 and extracellular alpha-2	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；295 K；0.2M patassium sodium tartrate tetrahydrate, 0.1M succinic acid, 16% polyethylene glycol 3350, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.70 Å R-free 0.287

4 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	HA2U_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 6–183； UniProt 1–178

H-2 class II histocompatibility antigen, A-U beta chain

Mus musculus

UniProt P06344

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain D； UniProt 29–217	Fragment：extracellular beta-1, extracellular beta-2	T cell receptor alpha chain × 1 （Q5R1F5） T cell receptor beta chain × 1 （A2NTY6） H-2 class II histocompatibility antigen, A-U alpha chain × 1 （P14438） Myelin basic protein (MBP)-peptide × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7；295 K；0.2M Potassium sodium tartrate tetrahydrate, 0.1M succinic acid (pH7.0), 16% polyethylene glycol 3350, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.23 Å R-free 0.253

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2PXY	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1K2D Crystal structure of the autoimmune MHC class II I-Au complexed with myelin basic protein 1-11 at 2.2A Deposited 2001-09-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 28–216（189 aa） Fragment：EXTRACELLULAR BETA-1 AND BETA-2 DOMAINS	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；296 K；MPEG 5000, sodium chloride, citrate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 296K	Resolution 2.20 Å R-free 0.276
1U3H Crystal structure of mouse TCR 172.10 complexed with MHC class II I-Au molecule at 2.4 A Deposited 2004-07-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 28–216（189 aa） Fragment：extracellular beta-1, extracellular beta-2	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；291 K；21% PEG 3350, 0.1M Hepes and 0.2M LiSO4, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.42 Å R-free 0.274
1U3H Crystal structure of mouse TCR 172.10 complexed with MHC class II I-Au molecule at 2.4 A Deposited 2004-07-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain H 28–216（189 aa） Fragment：extracellular beta-1, extracellular beta-2	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；291 K；21% PEG 3350, 0.1M Hepes and 0.2M LiSO4, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.42 Å R-free 0.274
2P24 I-Au/MBP125-135 Deposited 2007-03-06	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 28–224（197 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291.15 K；0.1 M NaOAc, 25% (w/v) PEG 1000, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 291.15K	Resolution 2.15 Å R-free 0.260
2Z31 Crystal structure of immune receptor complex Deposited 2007-05-30	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 28–216（189 aa） Fragment：extracellular beta-1 and extracellular beta-2	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；295 K；0.2M patassium sodium tartrate tetrahydrate, 0.1M succinic acid, 16% polyethylene glycol 3350, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.70 Å R-free 0.287

4 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	HB2U_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–189； UniProt 29–217

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2pxy
Deposition date deposition_date	2007-05-14
Structure title title	Crystal structures of immune receptor complexes
Keywords keywords	complex, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	29.95 Å
Radius of gyration Rg (electron density) rg_electron	29.66 Å
Forward intensity I(0) i0	79448400.00
Molecular weight molecular_weight	69074.0 kDa
Excluded volume excluded_volume	85732 Å³
Envelope volume envelope_volume	105880 Å³
Hydration-shell volume shell_volume	31577 Å³
Envelope diameter envelope_diameter	116.5 Å
Shell Rg shell_rg	34.64 Å
Envelope Rg envelope_rg	30.34 Å
Shape Rg shape_rg	29.59 Å
Total Rg total_rg	30.31 Å
Total atoms total_atoms	4883
Residues n_residues	604
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	107.8 Å
Rg (real space) rg_real	30.21 Å
Rg uncertainty (real space) rg_real_error	0.94 Å
I(0) (real space) i0_real	7.9450e+07
I(0) uncertainty (real space) i0_real_error	1.3380e+06
Rg (reciprocal space) rg_reciprocal	30.10 Å
I(0) (reciprocal space) i0_reciprocal	79440000.0000
Solution quality estimate total_estimate	0.8291
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	30.5 Å
Skewness Skewness skewness	0.622
Kurtosis Kurtosis kurtosis	0.058
Angular range angular_range	— – 0.2650 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	11840000.0000
Real-space data points n_real_points	54
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.675; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.805; Smooth: 0.943

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	T cell receptor alpha chain
Molecular weight formula_weight	12537.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	5212

SADSVTQTGGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALSENYGNEKITFGAGTKLQVVP

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	T cell receptor beta chain
Molecular weight formula_weight	12079.2 kDa
Mutation mutation	G17E,H47Y,I75T,L78S
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

AVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHGLRLIYYSYGAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGDASGAETLYFGPGTRLTVL

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	H-2 class II histocompatibility antigen, A-U alpha chain
Molecular weight formula_weight	20771.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

DDIEADHVGSYGIVVYQSPGDIGQYTFEFDGDELFYVDLDKKETIWMLPEFAQLRSFDPQGGLQNIATGKHNLGVLTKRSNSTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEP

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Drosophila melanogaster

Entity 4 Entity 4 polymer

Description description	H-2 class II histocompatibility antigen, A-U beta chain
Molecular weight formula_weight	22566.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

DSERHFVVQFQPFCYFTNGTQRIRYVTRYIYNREEYLRFDSDVGEYRAVTELGRPDAEYYNKQYLERTRAELDTVCRYNYEETEVPTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRAQ

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Drosophila melanogaster

Entity 5 Entity 5 polymer

Description description	Myelin basic protein (MBP)-peptide
Molecular weight formula_weight	1433.5 kDa
Mutation mutation	K4Y
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

HSRGGASQYRPSQ

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	329

▼

7. Fold Classification (SCOP + CATH) 13 domains

SCOP 2.08 (7 domains)

Domain ID domain_id	d2pxya_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d2pxyb_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d2pxyc1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.2 — C1 set domains (antibody constant domain-like)

Domain ID domain_id	d2pxyc2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.19 — MHC antigen-recognition domain
Superfamily Superfamily superfamily	d.19.1 — MHC antigen-recognition domain
Family Family family	d.19.1.1 — MHC antigen-recognition domain

Domain ID domain_id	d2pxyc3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2pxyd1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.2 — C1 set domains (antibody constant domain-like)

Domain ID domain_id	d2pxyd2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.19 — MHC antigen-recognition domain
Superfamily Superfamily superfamily	d.19.1 — MHC antigen-recognition domain
Family Family family	d.19.1.1 — MHC antigen-recognition domain

CATH v4.4 (6 domains)

Domain ID domain_id	2pxyA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	2pxyB00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	2pxyC01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	320 — Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1
Homologous superfamily homologous superfamily	10 — Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1

Domain ID domain_id	2pxyC02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	2pxyD01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	320 — Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1
Homologous superfamily homologous superfamily	10 — Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1

Domain ID domain_id	2pxyD02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	97.603 Å
Unit-cell length b length_b	97.603 Å
Unit-cell length c length_c	175.561 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 41 2 2
Space-group number int_tables_number	91
Crystal system crystal_system	—

Resolution resolution	2.230 Å
Low-resolution limit resolution_low	47.000 Å
R factor r_factor	—
R_work r_work	0.2180
R_free r_free	0.2530

fit	/app/data/saxs_computation/px/2pxy/2pxy.fit
pddf	/app/data/pr_computation/px/2pxy/2pxy.pr.out
profile	/app/data/saxs_computation/px/2pxy/2pxy.dat

Crystal structures of immune receptor complexes

1. Protein Identity and Related Structures Protein Identity & Related Structures

T cell receptor alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

T cell receptor beta chain

State in the Current Structure

Other States of the Same Protein in the Database

H-2 class II histocompatibility antigen, A-U alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

H-2 class II histocompatibility antigen, A-U beta chain

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 water

7. Fold Classification (SCOP + CATH) 13 domains

SCOP 2.08 (7 domains)

CATH v4.4 (6 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)