SAXSdb — 2q2g

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Heat shock 40 kDa protein, putative (fragment)

Cryptosporidium parvum Iowa II

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	SULFATE ION × 2 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 4	SULFATE ION × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A3FQ69_CRYPV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–180； UniProt 148–326 Author chain B； PDBConstruct 2–180； UniProt 148–326

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2q2g
Deposition date deposition_date	2007-05-28
Structure title title	Crystal structure of dimerization domain of HSP40 from Cryptosporidium parvum, cgd2_1800
Keywords keywords	heat shock, cryptosporidium, parvum, malaria, Structural Genomics, Structural Genomics Consortium, SGC, CHAPERONE; CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2q2g__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2q2g__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2q2g__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.91 Å
Rg (electron density)	42.39 Å
Total Rg	42.83 Å
Atom count	5386
Residues	666
Excluded volume	97750 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2q2g__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2q2g__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Heat shock 40 kDa protein, putative (fragment)
Molecular weight formula_weight	20523.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2979

GAPRSHEVPLLVTLEELYLGKRKKIKVTRKRFIEHKVRNEENIVEVEIKPGWKDGTKLTYSGEGDQESPGTSPGDLVLIIQTKTHPRFTRDDCHLIMKVTIPLVRALTGFTCPVTTLDNRNLQIPIKEIVNPKTRKIVPNEGMPIKNQPGQKGDLILEFDICFPKSLTPEQKKLIKEALD

Source Source

Source organism organism	Cryptosporidium parvum Iowa II
NCBI taxonomy ID ncbi_taxonomy_id	353152
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	286

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2q2ga1
Class class	b — All beta proteins
Fold Fold fold	b.4 — HSP40/DnaJ peptide-binding domain
Superfamily Superfamily superfamily	b.4.1 — HSP40/DnaJ peptide-binding domain
Family Family family	b.4.1.0 — automated matches

Domain ID domain_id	d2q2ga2
Class class	b — All beta proteins
Fold Fold fold	b.4 — HSP40/DnaJ peptide-binding domain
Superfamily Superfamily superfamily	b.4.1 — HSP40/DnaJ peptide-binding domain
Family Family family	b.4.1.0 — automated matches

Domain ID domain_id	d2q2gb1
Class class	b — All beta proteins
Fold Fold fold	b.4 — HSP40/DnaJ peptide-binding domain
Superfamily Superfamily superfamily	b.4.1 — HSP40/DnaJ peptide-binding domain
Family Family family	b.4.1.0 — automated matches

Domain ID domain_id	d2q2gb2
Class class	b — All beta proteins
Fold Fold fold	b.4 — HSP40/DnaJ peptide-binding domain
Superfamily Superfamily superfamily	b.4.1 — HSP40/DnaJ peptide-binding domain
Family Family family	b.4.1.0 — automated matches

CATH v4.4 (4 domains)

Domain ID domain_id	2q2gA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	260 — HSP40/DNAj peptide-binding domain
Homologous superfamily homologous superfamily	20 — Urease metallochaperone UreE, N-terminal domain

Domain ID domain_id	2q2gA02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	260 — HSP40/DNAj peptide-binding domain
Homologous superfamily homologous superfamily	20 — Urease metallochaperone UreE, N-terminal domain

Domain ID domain_id	2q2gB01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	260 — HSP40/DNAj peptide-binding domain
Homologous superfamily homologous superfamily	20 — Urease metallochaperone UreE, N-terminal domain

Domain ID domain_id	2q2gB02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	260 — HSP40/DNAj peptide-binding domain
Homologous superfamily homologous superfamily	20 — Urease metallochaperone UreE, N-terminal domain

▶

Unit-cell length a length_a	162.480 Å
Unit-cell length b length_b	60.590 Å
Unit-cell length c length_c	48.830 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	106.19 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2488
R_work r_work	0.2488
R_free r_free	0.2909

Crystal structure of dimerization domain of HSP40 from Cryptosporidium parvum, cgd2_1800

1. Protein Identity and Related Structures Protein Identity & Related Structures

Heat shock 40 kDa protein, putative (fragment)

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2q2g__assembly_2__model_1

2q2g__assembly_2__model_1 | I(q)

2q2g__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of dimerization domain of HSP40 from Cryptosporidium parvum, cgd2_1800

1. Protein Identity and Related Structures Protein Identity & Related Structures

Heat shock 40 kDa protein, putative (fragment)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2q2g__assembly_2__model_1

2q2g__assembly_2__model_1 | I(q)

2q2g__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)