2q3t

Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At3g22680

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein At3g22680

Arabidopsis thaliana

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	SULFATE ION × 6 3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE × 2 1,2-ETHANEDIOL × 8 water × 2	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	SULFATE ION × 3 3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE × 1 1,2-ETHANEDIOL × 4 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Y3268_ARATH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–157； UniProt 8–163

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2q3t
Deposition date deposition_date	2007-05-30
Structure title title	Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At3g22680
Keywords keywords	;Ensemble Refinement, Refinement Methodology Development, UNKNOWN FUNCTION, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG ;; STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2q3t__assembly_2__model_9

Assembly 2 · Model 9 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2q3t__assembly_2__model_9 | I(q)

100 plotted points; both axes use logarithmic scales.

2q3t__assembly_2__model_9 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.71 Å
Rg (electron density)	15.42 Å
Total Rg	16.59 Å
Atom count	1066
Residues	121
Excluded volume	19099 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2q3t__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	2	`2q3t__assembly_1__model_2`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	3	`2q3t__assembly_1__model_3`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	4	`2q3t__assembly_1__model_4`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	5	`2q3t__assembly_1__model_5`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	6	`2q3t__assembly_1__model_6`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	7	`2q3t__assembly_1__model_7`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	8	`2q3t__assembly_1__model_8`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	9	`2q3t__assembly_1__model_9`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	10	`2q3t__assembly_1__model_10`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	11	`2q3t__assembly_1__model_11`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	12	`2q3t__assembly_1__model_12`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	13	`2q3t__assembly_1__model_13`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	14	`2q3t__assembly_1__model_14`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	15	`2q3t__assembly_1__model_15`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	16	`2q3t__assembly_1__model_16`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2q3t__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	2	`2q3t__assembly_2__model_2`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	3	`2q3t__assembly_2__model_3`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	4	`2q3t__assembly_2__model_4`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	5	`2q3t__assembly_2__model_5`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	6	`2q3t__assembly_2__model_6`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	7	`2q3t__assembly_2__model_7`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	8	`2q3t__assembly_2__model_8`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	9	`2q3t__assembly_2__model_9`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	10	`2q3t__assembly_2__model_10`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	11	`2q3t__assembly_2__model_11`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	12	`2q3t__assembly_2__model_12`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	13	`2q3t__assembly_2__model_13`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	14	`2q3t__assembly_2__model_14`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	15	`2q3t__assembly_2__model_15`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	16	`2q3t__assembly_2__model_16`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Protein At3g22680
Molecular weight formula_weight	18003.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	19808

SELRPSGDSGSSDVDAEISDGFSPLDTSHRDVADEGSLLRRAEMYQDYMKQVPIPTNRGSLIPFTSWVGLSISMKQLYGQPLHYLTNVLLQRWDQSRFGTDSEEQRLDSIIHPTKAEATIWLVEEIHRLTPSHLHMALLWRSDPMYHSFIDPIFPEK

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 non-polymer

Description description	3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE
Molecular weight formula_weight	614.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	172

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d2q3ta_
Class class	a — All alpha proteins
Fold Fold fold	a.220 — Hypothetical protein At3g22680
Superfamily Superfamily superfamily	a.220.1 — Hypothetical protein At3g22680
Family Family family	a.220.1.1 — Hypothetical protein At3g22680

CATH v4.4 (1 domains)

Domain ID domain_id	2q3tA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	690 — RDM1 protein domain

▶

Unit-cell length a length_a	83.450 Å
Unit-cell length b length_b	83.450 Å
Unit-cell length c length_c	60.575 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 31 2 1
Space-group number int_tables_number	152
Crystal system crystal_system	—

Resolution resolution	1.600 Å
Low-resolution limit resolution_low	31.030 Å
R factor r_factor	0.1390
R_work r_work	0.1390
R_free r_free	0.1700

Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At3g22680

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein At3g22680

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2q3t__assembly_2__model_9

2q3t__assembly_2__model_9 | I(q)

2q3t__assembly_2__model_9 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (2)

Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At3g22680

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein At3g22680

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2q3t__assembly_2__model_9

2q3t__assembly_2__model_9 | I(q)

2q3t__assembly_2__model_9 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (2)