SAXSdb — 2vqg

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

UNCHARACTERIZED PROTEIN CGL0972

CORYNEBACTERIUM GLUTAMICUM

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	ZINC ION × 7 CACODYLATE ION × 4 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	ZINC ION × 6 CACODYLATE ION × 2 ACETATE ION × 1 (4R)-2-METHYLPENTANE-2,4-DIOL × 1 water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	ZINC ION × 7 CACODYLATE ION × 4 water × 1	Consistent with protein count
4	Protein monomer	Monomer	Protein 1	ZINC ION × 6 water × 1	Consistent with protein count
5	Protein monomer	Monomer	Protein 1	ZINC ION × 2 ACETATE ION × 1 3,6,9,12,15,18,21,24,27-nonaoxaheptatriacontan-1-ol × 1 water × 1	Consistent with protein count
6	Protein monomer	Monomer	Protein 1	ZINC ION × 5 water × 1	Consistent with protein count
7	Protein monomer	Monomer	Protein 1	ZINC ION × 4 CACODYLATE ION × 1 (4R)-2-METHYLPENTANE-2,4-DIOL × 1 water × 1	Consistent with protein count
8	Protein monomer	Monomer	Protein 1	ZINC ION × 2 (4R)-2-METHYLPENTANE-2,4-DIOL × 1 water × 1	Consistent with protein count
9	Protein monomer	Monomer	Protein 1	ZINC ION × 3 CACODYLATE ION × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8NRS3_CORGL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–99； UniProt 28–126 Author chain B； PDBConstruct 1–99； UniProt 28–126 Author chain C； PDBConstruct 1–99； UniProt 28–126 Author chain D； PDBConstruct 1–99； UniProt 28–126 Author chain E； PDBConstruct 1–99； UniProt 28–126 Author chain F； PDBConstruct 1–99； UniProt 28–126 Author chain G； PDBConstruct 1–99； UniProt 28–126 Author chain H； PDBConstruct 1–99； UniProt 28–126 Author chain I； PDBConstruct 1–99； UniProt 28–126

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2vqg
Deposition date deposition_date	2008-03-15
Structure title title	Crystal structure of PorB from Corynebacterium glutamicum (crystal form I)
Keywords keywords	TRANSMEMBRANE, MEMBRANE PROTEIN, PORIN, MEMBRANE, TRANSPORT, ION TRANSPORT; MEMBRANE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2vqg__assembly_6__model_1

Assembly 6 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2vqg__assembly_6__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2vqg__assembly_6__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	14.45 Å
Rg (electron density)	13.89 Å
Total Rg	14.82 Å
Atom count	579
Residues	76
Excluded volume	10216 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2vqg__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2vqg__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2vqg__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2vqg__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`2vqg__assembly_5__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`2vqg__assembly_6__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`2vqg__assembly_7__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`2vqg__assembly_8__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`2vqg__assembly_9__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	UNCHARACTERIZED PROTEIN CGL0972
Molecular weight formula_weight	10643.5 kDa
Source method src_method	man
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I
Atom count atom_count	5974

SDFANLSSTNKELSPQYNWVACGILEGGLKAAGVLEEGQYNRELAEAIAAKGEGFWTTQFPQIGDWNEDQAAALADRAQTCGLVKADTYLSELSSNFSS

Source Source

Source organism organism	CORYNEBACTERIUM GLUTAMICUM
NCBI taxonomy ID ncbi_taxonomy_id	1718
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	42

Entity 3 Entity 3 non-polymer

Description description	CACODYLATE ION
Molecular weight formula_weight	137.0 kDa
Source method src_method	syn
Copy count entity_count	13

Entity 4 Entity 4 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	(4R)-2-METHYLPENTANE-2,4-DIOL
Molecular weight formula_weight	118.2 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 6 Entity 6 non-polymer

Description description	3,6,9,12,15,18,21,24,27-nonaoxaheptatriacontan-1-ol
Molecular weight formula_weight	554.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	430

▼

6. Fold Classification (SCOP + CATH) 9 domains

CATH v4.4 (9 domains)

Domain ID domain_id	2vqgA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	1280 — Alpha-helical porin B/porin C

Domain ID domain_id	2vqgB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	1280 — Alpha-helical porin B/porin C

Domain ID domain_id	2vqgC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	1280 — Alpha-helical porin B/porin C

Domain ID domain_id	2vqgD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	1280 — Alpha-helical porin B/porin C

Domain ID domain_id	2vqgE00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	1280 — Alpha-helical porin B/porin C

Domain ID domain_id	2vqgF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	1280 — Alpha-helical porin B/porin C

Domain ID domain_id	2vqgG00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	1280 — Alpha-helical porin B/porin C

Domain ID domain_id	2vqgH00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	1280 — Alpha-helical porin B/porin C

Domain ID domain_id	2vqgI00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	1280 — Alpha-helical porin B/porin C

▶

Unit-cell length a length_a	87.070 Å
Unit-cell length b length_b	87.070 Å
Unit-cell length c length_c	260.530 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	72

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	1.820 Å
Low-resolution limit resolution_low	72.360 Å
R factor r_factor	0.1960
R_work r_work	0.1950
R_free r_free	0.2150

Crystal structure of PorB from Corynebacterium glutamicum (crystal form I)

1. Protein Identity and Related Structures Protein Identity & Related Structures

UNCHARACTERIZED PROTEIN CGL0972

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2vqg__assembly_6__model_1

2vqg__assembly_6__model_1 | I(q)

2vqg__assembly_6__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 9 domains

CATH v4.4 (9 domains)

7. Citations (1)

Crystal structure of PorB from Corynebacterium glutamicum (crystal form I)

1. Protein Identity and Related Structures Protein Identity & Related Structures

UNCHARACTERIZED PROTEIN CGL0972

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2vqg__assembly_6__model_1

2vqg__assembly_6__model_1 | I(q)

2vqg__assembly_6__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 9 domains

CATH v4.4 (9 domains)

7. Citations (1)