2vxj

CRYSTAL STRUCTURE OF PA-IL LECTIN COMPLEXED WITH AGAL13BGAL14GLC AT 1.9 A RESOLUTION

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PA-I GALACTOPHILIC LECTIN

PSEUDOMONAS AERUGINOSA

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 1,2-ETHANEDIOL × 1 water × 1	Consistent with protein count
10	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 water × 1	Consistent with protein count
11	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 water × 1	Consistent with protein count
12	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 1,2-ETHANEDIOL × 1 water × 1	Consistent with protein count
13	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 1,2-ETHANEDIOL × 2 water × 1	Consistent with protein count
14	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose × 1 CALCIUM ION × 1 1,2-ETHANEDIOL × 1 beta-D-glucopyranose × 1 water × 1	Consistent with protein count
15	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 1,2-ETHANEDIOL × 1 water × 1	Consistent with protein count
16	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 water × 1	Consistent with protein count
17	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 1,2-ETHANEDIOL × 2 water × 1	Consistent with protein count
18	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 water × 1	Consistent with protein count
19	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 1,2-ETHANEDIOL × 1 water × 1	Consistent with protein count
2	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 water × 1	Consistent with protein count
20	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 water × 1	Consistent with protein count
21	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 1,2-ETHANEDIOL × 1 water × 1	Consistent with protein count
22	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 1,2-ETHANEDIOL × 1 water × 1	Consistent with protein count
23	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 1,2-ETHANEDIOL × 2 water × 1	Consistent with protein count
24	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 1,2-ETHANEDIOL × 1 water × 1	Consistent with protein count
3	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-alpha-D-glucopyranose × 1 CALCIUM ION × 1 water × 1	Consistent with protein count
4	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 1,2-ETHANEDIOL × 1 water × 1	Consistent with protein count
5	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-alpha-D-glucopyranose × 1 CALCIUM ION × 1 1,2-ETHANEDIOL × 1 water × 1	Consistent with protein count
6	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 water × 1	Consistent with protein count
7	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 1,2-ETHANEDIOL × 1 water × 1	Consistent with protein count
8	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 1,2-ETHANEDIOL × 1 water × 1	Consistent with protein count
9	Other combination	Monomer	Protein 1 其他Polymer 1	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose × 1 CALCIUM ION × 1 1,2-ETHANEDIOL × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PA1L_PSEAE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–121； UniProt 2–122 Author chain B； PDBConstruct 1–121； UniProt 2–122 Author chain C； PDBConstruct 1–121； UniProt 2–122 Author chain D； PDBConstruct 1–121； UniProt 2–122 Author chain E； PDBConstruct 1–121； UniProt 2–122 Author chain F； PDBConstruct 1–121； UniProt 2–122 Author chain G； PDBConstruct 1–121； UniProt 2–122 Author chain H； PDBConstruct 1–121； UniProt 2–122 Author chain I； PDBConstruct 1–121； UniProt 2–122 Author chain J； PDBConstruct 1–121； UniProt 2–122 Author chain K； PDBConstruct 1–121； UniProt 2–122 Author chain L； PDBConstruct 1–121； UniProt 2–122 Author chain M； PDBConstruct 1–121； UniProt 2–122 Author chain N； PDBConstruct 1–121； UniProt 2–122 Author chain O； PDBConstruct 1–121； UniProt 2–122 Author chain P； PDBConstruct 1–121； UniProt 2–122 Author chain Q； PDBConstruct 1–121； UniProt 2–122 Author chain R； PDBConstruct 1–121； UniProt 2–122 Author chain S； PDBConstruct 1–121； UniProt 2–122 Author chain T； PDBConstruct 1–121； UniProt 2–122 Author chain U； PDBConstruct 1–121； UniProt 2–122 Author chain V； PDBConstruct 1–121； UniProt 2–122 Author chain W； PDBConstruct 1–121； UniProt 2–122 Author chain X； PDBConstruct 1–121； UniProt 2–122

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2vxj
Deposition date deposition_date	2008-07-04
Structure title title	CRYSTAL STRUCTURE OF PA-IL LECTIN COMPLEXED WITH AGAL13BGAL14GLC AT 1.9 A RESOLUTION
Keywords keywords	LECTIN, GLOBOSIDE, SUGAR BINDING PROTEIN; SUGAR BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2vxj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2vxj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2vxj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.49 Å
Rg (electron density)	14.30 Å
Total Rg	15.40 Å
Atom count	940
Residues	121
Excluded volume	16567 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2vxj__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2vxj__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2vxj__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2vxj__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`2vxj__assembly_5__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`2vxj__assembly_6__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`2vxj__assembly_7__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`2vxj__assembly_8__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`2vxj__assembly_9__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
10	1	`2vxj__assembly_10__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
11	1	`2vxj__assembly_11__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
12	1	`2vxj__assembly_12__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
13	1	`2vxj__assembly_13__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
14	1	`2vxj__assembly_14__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
15	1	`2vxj__assembly_15__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
16	1	`2vxj__assembly_16__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
17	1	`2vxj__assembly_17__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
18	1	`2vxj__assembly_18__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
19	1	`2vxj__assembly_19__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
20	1	`2vxj__assembly_20__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
21	1	`2vxj__assembly_21__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
22	1	`2vxj__assembly_22__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
23	1	`2vxj__assembly_23__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
24	1	`2vxj__assembly_24__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	PA-I GALACTOPHILIC LECTIN
Molecular weight formula_weight	12770.1 kDa
Source method src_method	man
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X
Atom count atom_count	25600

AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS

Source Source

Source organism organism	PSEUDOMONAS AERUGINOSA
NCBI taxonomy ID ncbi_taxonomy_id	208964
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 branched

Description description	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-beta-D-glucopyranose
Molecular weight formula_weight	504.4 kDa
Source method src_method	man
Copy count entity_count	21

Entity 3 Entity 3 branched

Description description	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose-(1-4)-alpha-D-glucopyranose
Molecular weight formula_weight	504.4 kDa
Source method src_method	man
Copy count entity_count	2

Entity 4 Entity 4 branched

Description description	alpha-D-galactopyranose-(1-3)-beta-D-galactopyranose
Molecular weight formula_weight	342.3 kDa
Source method src_method	man
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	24

Entity 6 Entity 6 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	20

Entity 7 Entity 7 non-polymer

Description description	beta-D-glucopyranose
Molecular weight formula_weight	180.2 kDa
Source method src_method	man
Copy count entity_count	1

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	3046

▼

6. Fold Classification (SCOP + CATH) 48 domains

SCOP 2.08 (24 domains)

Domain ID domain_id	d2vxja_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjb_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjc_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjd_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxje_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjf_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjg_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjh_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxji_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjj_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjk_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjl_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjm_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjn_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjo_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjp_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjq_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjr_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjs_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjt_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxju_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjv_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjw_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

Domain ID domain_id	d2vxjx_
Class class	b — All beta proteins
Fold Fold fold	b.18 — Galactose-binding domain-like
Superfamily Superfamily superfamily	b.18.1 — Galactose-binding domain-like
Family Family family	b.18.1.16 — PA-IL, galactose-binding lectin 1

CATH v4.4 (24 domains)

Domain ID domain_id	2vxjA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjB00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjC00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjD00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjE00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjF00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjG00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjH00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjI00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjJ00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjK00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjL00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjM00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjN00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjO00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjP00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjQ00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjR00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjS00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjT00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjU00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjV00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjW00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

Domain ID domain_id	2vxjX00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	430 — Galactose-binding lectin

▶

Unit-cell length a length_a	79.184 Å
Unit-cell length b length_b	86.521 Å
Unit-cell length c length_c	119.078 Å
Unit-cell angle α angle_alpha	93.93 °
Unit-cell angle β angle_beta	98.16 °
Unit-cell angle γ angle_gamma	90.08 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	55.000 Å
R factor r_factor	0.1880
R_work r_work	0.1850
R_free r_free	0.2450

CRYSTAL STRUCTURE OF PA-IL LECTIN COMPLEXED WITH AGAL13BGAL14GLC AT 1.9 A RESOLUTION

1. Protein Identity and Related Structures Protein Identity & Related Structures

PA-I GALACTOPHILIC LECTIN

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2vxj__assembly_1__model_1

2vxj__assembly_1__model_1 | I(q)

2vxj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 branched

Entity 3 Entity 3 branched

Entity 4 Entity 4 branched

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

6. Fold Classification (SCOP + CATH) 48 domains

SCOP 2.08 (24 domains)

CATH v4.4 (24 domains)

7. Citations (1)

CRYSTAL STRUCTURE OF PA-IL LECTIN COMPLEXED WITH AGAL13BGAL14GLC AT 1.9 A RESOLUTION

1. Protein Identity and Related Structures Protein Identity & Related Structures

PA-I GALACTOPHILIC LECTIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2vxj__assembly_1__model_1

2vxj__assembly_1__model_1 | I(q)

2vxj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 branched

Entity 3 Entity 3 branched

Entity 4 Entity 4 branched

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

6. Fold Classification (SCOP + CATH) 48 domains

SCOP 2.08 (24 domains)

CATH v4.4 (24 domains)

7. Citations (1)