SAXSdb — 2w0c

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

MAJOR CAPSID PROTEIN P2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 960	PROTEIN 2 × 60 （Q9XJR3） PROTEIN P3 × 240 （Q9XJR6） PROTEIN P6 × 60 （Q9XJR1） CALCIUM ION × 660	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	PROTEIN 2 × 1 （Q9XJR3） PROTEIN P3 × 4 （Q9XJR6） PROTEIN P6 × 1 （Q9XJR1） CALCIUM ION × 11	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 80	PROTEIN 2 × 5 （Q9XJR3） PROTEIN P3 × 20 （Q9XJR6） PROTEIN P6 × 5 （Q9XJR1） CALCIUM ION × 55	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 96	PROTEIN 2 × 6 （Q9XJR3） PROTEIN P3 × 24 （Q9XJR6） PROTEIN P6 × 6 （Q9XJR1） CALCIUM ION × 66	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 16	PROTEIN 2 × 1 （Q9XJR3） PROTEIN P3 × 4 （Q9XJR6） PROTEIN P6 × 1 （Q9XJR1） CALCIUM ION × 11	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 960	PROTEIN 2 × 60 （Q9XJR3） PROTEIN P3 × 240 （Q9XJR6） PROTEIN P6 × 60 （Q9XJR1） CALCIUM ION × 660	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPSD_BPPM2
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–269； UniProt 1–269 Author chain B； PDBConstruct 1–269； UniProt 1–269 Author chain C； PDBConstruct 1–269； UniProt 1–269 Author chain D； PDBConstruct 1–269； UniProt 1–269 Author chain E； PDBConstruct 1–269； UniProt 1–269 Author chain F； PDBConstruct 1–269； UniProt 1–269 Author chain G； PDBConstruct 1–269； UniProt 1–269 Author chain H； PDBConstruct 1–269； UniProt 1–269 Author chain I； PDBConstruct 1–269； UniProt 1–269 Author chain J； PDBConstruct 1–269； UniProt 1–269

PROTEIN 2

OrganismNot specified

UniProt Q9XJR3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 960	MAJOR CAPSID PROTEIN P2 × 600 （P15794） PROTEIN P3 × 240 （Q9XJR6） PROTEIN P6 × 60 （Q9XJR1） CALCIUM ION × 660	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	MAJOR CAPSID PROTEIN P2 × 10 （P15794） PROTEIN P3 × 4 （Q9XJR6） PROTEIN P6 × 1 （Q9XJR1） CALCIUM ION × 11	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 80	MAJOR CAPSID PROTEIN P2 × 50 （P15794） PROTEIN P3 × 20 （Q9XJR6） PROTEIN P6 × 5 （Q9XJR1） CALCIUM ION × 55	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 96	MAJOR CAPSID PROTEIN P2 × 60 （P15794） PROTEIN P3 × 24 （Q9XJR6） PROTEIN P6 × 6 （Q9XJR1） CALCIUM ION × 66	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 16	MAJOR CAPSID PROTEIN P2 × 10 （P15794） PROTEIN P3 × 4 （Q9XJR6） PROTEIN P6 × 1 （Q9XJR1） CALCIUM ION × 11	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 960	MAJOR CAPSID PROTEIN P2 × 600 （P15794） PROTEIN P3 × 240 （Q9XJR6） PROTEIN P6 × 60 （Q9XJR1） CALCIUM ION × 660	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPIKE_BPPM2
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain L； PDBConstruct 1–335； UniProt 1–335

PROTEIN P3

OrganismNot specified

UniProt Q9XJR6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 960	MAJOR CAPSID PROTEIN P2 × 600 （P15794） PROTEIN 2 × 60 （Q9XJR3） PROTEIN P6 × 60 （Q9XJR1） CALCIUM ION × 660	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	MAJOR CAPSID PROTEIN P2 × 10 （P15794） PROTEIN 2 × 1 （Q9XJR3） PROTEIN P6 × 1 （Q9XJR1） CALCIUM ION × 11	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 80	MAJOR CAPSID PROTEIN P2 × 50 （P15794） PROTEIN 2 × 5 （Q9XJR3） PROTEIN P6 × 5 （Q9XJR1） CALCIUM ION × 55	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 96	MAJOR CAPSID PROTEIN P2 × 60 （P15794） PROTEIN 2 × 6 （Q9XJR3） PROTEIN P6 × 6 （Q9XJR1） CALCIUM ION × 66	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 16	MAJOR CAPSID PROTEIN P2 × 10 （P15794） PROTEIN 2 × 1 （Q9XJR3） PROTEIN P6 × 1 （Q9XJR1） CALCIUM ION × 11	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 960	MAJOR CAPSID PROTEIN P2 × 600 （P15794） PROTEIN 2 × 60 （Q9XJR3） PROTEIN P6 × 60 （Q9XJR1） CALCIUM ION × 660	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	P3_BPPM2
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain P； PDBConstruct 1–104； UniProt 1–104 Author chain Q； PDBConstruct 1–104； UniProt 1–104 Author chain R； PDBConstruct 1–104； UniProt 1–104 Author chain S； PDBConstruct 1–104； UniProt 1–104

PROTEIN P6

OrganismNot specified

UniProt Q9XJR1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 960	MAJOR CAPSID PROTEIN P2 × 600 （P15794） PROTEIN 2 × 60 （Q9XJR3） PROTEIN P3 × 240 （Q9XJR6） CALCIUM ION × 660	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	MAJOR CAPSID PROTEIN P2 × 10 （P15794） PROTEIN 2 × 1 （Q9XJR3） PROTEIN P3 × 4 （Q9XJR6） CALCIUM ION × 11	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 80	MAJOR CAPSID PROTEIN P2 × 50 （P15794） PROTEIN 2 × 5 （Q9XJR3） PROTEIN P3 × 20 （Q9XJR6） CALCIUM ION × 55	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 96	MAJOR CAPSID PROTEIN P2 × 60 （P15794） PROTEIN 2 × 6 （Q9XJR3） PROTEIN P3 × 24 （Q9XJR6） CALCIUM ION × 66	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 16	MAJOR CAPSID PROTEIN P2 × 10 （P15794） PROTEIN 2 × 1 （Q9XJR3） PROTEIN P3 × 4 （Q9XJR6） CALCIUM ION × 11	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 960	MAJOR CAPSID PROTEIN P2 × 600 （P15794） PROTEIN 2 × 60 （Q9XJR3） PROTEIN P3 × 240 （Q9XJR6） CALCIUM ION × 660	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	P6_BPPM2
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain T； PDBConstruct 1–127； UniProt 1–127

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2w0c
Deposition date deposition_date	2008-08-13
Structure title title	X-ray structure of the entire lipid-containing bacteriophage PM2
Keywords keywords	VIRUS, MEMBER OF PRD1-ADENO VIRAL LINEAGE, MEMBRANE-CONTAINING BACTERIOPHAGE, VIRUS VIRION, MEMBRANE, TRANSMEMBRANE, CAPSID PROTEIN; VIRUS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2w0c__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2w0c__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2w0c__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	279.70 Å
Total Rg	279.50 Å
Atom count	1586820
Residues	205440
Excluded volume	28314000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2w0c__assembly_1__model_1`	960-MERIC （960）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2w0c__assembly_2__model_1`	hexadecameric （16）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`2w0c__assembly_3__model_1`	80-meric （80）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`2w0c__assembly_4__model_1`	96-meric （96）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`2w0c__assembly_5__model_1`	hexadecameric （16）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
6	1	`2w0c__assembly_6__model_1`	960-meric （960）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	MAJOR CAPSID PROTEIN P2
Molecular weight formula_weight	30233.7 kDa
Source method src_method	nat
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J
Atom count atom_count	26447

MRSFLNLNSIPNVAAGNSCSIKLPIGQTYEVIDLRYSGVTPSQIKNVRVELDGRLLSTYKTLNDLILENTRHKRKIKAGVVSFHFVRPEMKGVNVTDLVQQRMFALGTVGLTTCEIKFDIDEAAAGPKLSAIAQKSVGTAPSWLTMRRNFFKQLNNGTTEIADLPRPVGYRIAAIHIKAAGVDAVEFQIDGTKWRDLLKKADNDYILEQYGKAVLDNTYTIDFMLEGDVYQSVLLDQMIQDLRLKIDSTMDEQAEIIVEYMGVWSRNGF

Entity 2 Entity 2 polymer

Description description	PROTEIN 2
Molecular weight formula_weight	37540.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MIVKKKLAAGEFAETFKNGNNITIIKAVGELVLRAYGADGGEGLRTIVRQGVSIKGMNYTSVMLHTEYAQEIEYWVGDLDYSFQEQTTKSRDVNSFQIPLRDGVRELLPEDASRNRASIKSPVDIWIGGENMTALNGIVDGGRKFEAGQEFQINTFGSVNYWVSDEEIRVFKEYSARAKYAQNEGRTALEANNVPFFDIDVPPELDGVPFSLKARVRHKSKGVDGLGDYTSISVKPAFYITEGDETTDTLIKYTSYGSTGSHSGYDFDDNTLDVMVTLSAGVHRVFPVETELDYDAVQEVQHDWYDESFTTFIEVYSDDPLLTVKGYAQILMERT

Entity 3 Entity 3 polymer

Description description	PROTEIN P3
Molecular weight formula_weight	10767.4 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,Q,R,S

MNTSVPTSVPTNQSVWGNVSTGLDALISGWARVEQIKAAKASTGQGRVEQAMTPELDNGAAVVVEAPKKAAQPSETLVFGVPQKTLLLGFGGLLVLGLVMRGNK

Entity 4 Entity 4 polymer

Description description	PROTEIN P6
Molecular weight formula_weight	14363.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MANFLTKNFVWILAAGVGVWFYQKADNAAKTATKPIADFLAELQFLVNGSNYVKFPNAGFVLTRDALQDDFIAYDDRIKAWLGTHDRHKDFLAEILDHERRVKPVYRKLIGNIIDASTIRAASGVEL

Entity 5 Entity 5 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	11

▶

Unit-cell length a length_a	946.900 Å
Unit-cell length b length_b	677.600 Å
Unit-cell length c length_c	1067.600 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	102.90 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	2400

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	7.000 Å
Low-resolution limit resolution_low	96.000 Å
R factor r_factor	0.4190
R_work r_work	0.4190
R_free r_free	—

X-ray structure of the entire lipid-containing bacteriophage PM2

1. Protein Identity and Related Structures Protein Identity & Related Structures

MAJOR CAPSID PROTEIN P2

State in the Current Structure

Other States of the Same Protein in the Database

PROTEIN 2

State in the Current Structure

Other States of the Same Protein in the Database

PROTEIN P3

State in the Current Structure

Other States of the Same Protein in the Database

PROTEIN P6

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2w0c__assembly_1__model_1

2w0c__assembly_1__model_1 | I(q)

2w0c__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

7. Citations (3)

X-ray structure of the entire lipid-containing bacteriophage PM2

1. Protein Identity and Related Structures Protein Identity & Related Structures

MAJOR CAPSID PROTEIN P2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PROTEIN 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PROTEIN P3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PROTEIN P6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2w0c__assembly_1__model_1

2w0c__assembly_1__model_1 | I(q)

2w0c__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

7. Citations (3)