SAXSdb — 2wiz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ARCHAEAL HJC

ARCHAEOGLOBUS FULGIDUS DSM 4304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Homooligomer	Protein 4 DNA 4	HALF-JUNCTION × 2 HALF-JUNCTION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O28314_ARCFU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–139； UniProt 2–136 Author chain B； PDBConstruct 5–139； UniProt 2–136

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2wiz
Deposition date deposition_date	2009-05-18
Structure title title	Crystal structures of Holliday junction resolvases from Archaeoglobus fulgidus bound to DNA substrate
Keywords keywords	;HYDROLASE DNA COMPLEX, TYPE II RESTRICTION ENDONUCLEASE, HOLLIDAY JUNCTION RESOLVASE, HYDROLASE, DNA BINDING PROTEIN, HYDROLASE-DNA complex ;; HYDROLASE/DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2wiz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2wiz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2wiz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.71 Å
Rg (electron density)	29.43 Å
Total Rg	30.04 Å
Atom count	5582
Residues	574
Excluded volume	95285 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2wiz__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	ARCHAEAL HJC
Molecular weight formula_weight	15674.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2791

GTMGKSKGTRFERDLLVELWKAGFAAIRVAGSGVSPFPCPDIVAGNGRTYLAIEVKMRKELPLYLSADEVEQLVTFARGFGAEAYVALKLPRKKWRFFPVQMLERTEKNFKIDESVYPLGLEIAEVAGKFFQERFGEKV

Source Source

Source organism organism	ARCHAEOGLOBUS FULGIDUS DSM 4304
NCBI taxonomy ID ncbi_taxonomy_id	224325
Host organism host_organism	ESCHERICHIA COLI BL21(DE3)

Entity 2 Entity 2 polymer

Description description	HALF-JUNCTION
Molecular weight formula_weight	6078.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	C

GGATCCCTAAGCTCCATCGA

Entity 3 Entity 3 polymer

Description description	HALF-JUNCTION
Molecular weight formula_weight	6190.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	D

TCGATGGAGCTTAGGGATCC

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	2wizA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1350 — Trna Endonuclease; Chain: A, domain 1
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	2wizB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1350 — Trna Endonuclease; Chain: A, domain 1
Homologous superfamily homologous superfamily	10 —

▶

Unit-cell length a length_a	122.650 Å
Unit-cell length b length_b	122.650 Å
Unit-cell length c length_c	125.510 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 62 2 2
Space-group number int_tables_number	180
Crystal system crystal_system	—

Resolution resolution	3.300 Å
Low-resolution limit resolution_low	34.560 Å
R factor r_factor	0.2079
R_work r_work	0.2043
R_free r_free	0.2832

Crystal structures of Holliday junction resolvases from Archaeoglobus fulgidus bound to DNA substrate

1. Protein Identity and Related Structures Protein Identity & Related Structures

ARCHAEAL HJC

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2wiz__assembly_1__model_1

2wiz__assembly_1__model_1 | I(q)

2wiz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)

Crystal structures of Holliday junction resolvases from Archaeoglobus fulgidus bound to DNA substrate

1. Protein Identity and Related Structures Protein Identity & Related Structures

ARCHAEAL HJC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2wiz__assembly_1__model_1

2wiz__assembly_1__model_1 | I(q)

2wiz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)