SAXSdb — 2wua

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ACETOACETYL COA THIOLASE

HELIANTHUS ANNUUS

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6W6X6_HELAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–434； UniProt 17–449 Author chain B； PDBConstruct 2–434； UniProt 17–449

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2wua
Deposition date deposition_date	2009-10-01
Structure title title	Structure of the peroxisomal 3-ketoacyl-CoA thiolase from Sunflower
Keywords keywords	TRANSFERASE, BETA OXIDATION, PLANT LIPID METABOLISM, ACYLTRANSFERASE, CYSTEINE OXIDATION; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2wua__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2wua__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2wua__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	26.79 Å
Rg (electron density)	25.75 Å
Total Rg	26.61 Å
Atom count	5734
Residues	786
Excluded volume	102720 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2wua__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	ACETOACETYL COA THIOLASE
Molecular weight formula_weight	46030.7 kDa
EC 编号 ec_number	2.3.1.16
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	6584

MPSSTSSSLENLSVSVCAAGDSAAYQRNSVFGDDVVIVAAYRSPLCKAKRGGLKDTYPDDILAPVLKALIEKTNINPAEVGDIVVGSVLGAGSQRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNPKVKTMAQAQDCLLPMGITSENVAQKFSITRQEQDQAAVGSHRKTAAATAAGRFKDEIIPIKTKIVDPKTGDEKPVTISVDDGIRPGTSLADLAKLKPVFRKDGSTTAGTSSQVSDGAGAVLLMKRSIALQKGLPILGVFRTFAAVGVPPSIMGIGPAVAIPAAVKAAGLQIDDIDLFEINEAFASQFVYCQKKLEIDPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGDACDELCNAKAKHHHHHH

Source Source

Source organism organism	HELIANTHUS ANNUUS
Common name common_name	COMMON SUNFLOWER
NCBI taxonomy ID ncbi_taxonomy_id	4232
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	709

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2wuaa1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.95 — Thiolase-like
Superfamily Superfamily superfamily	c.95.1 — Thiolase-like
Family Family family	c.95.1.0 — automated matches

Domain ID domain_id	d2wuaa2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.95 — Thiolase-like
Superfamily Superfamily superfamily	c.95.1 — Thiolase-like
Family Family family	c.95.1.0 — automated matches

Domain ID domain_id	d2wuab1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.95 — Thiolase-like
Superfamily Superfamily superfamily	c.95.1 — Thiolase-like
Family Family family	c.95.1.0 — automated matches

Domain ID domain_id	d2wuab2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.95 — Thiolase-like
Superfamily Superfamily superfamily	c.95.1 — Thiolase-like
Family Family family	c.95.1.0 — automated matches

CATH v4.4 (2 domains)

Domain ID domain_id	2wuaA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	47 — Peroxisomal Thiolase; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Thiolase/Chalcone synthase

Domain ID domain_id	2wuaB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	47 — Peroxisomal Thiolase; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Thiolase/Chalcone synthase

▶

Unit-cell length a length_a	78.596 Å
Unit-cell length b length_b	100.692 Å
Unit-cell length c length_c	105.296 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	50.346 Å
R factor r_factor	0.1872
R_work r_work	0.1856
R_free r_free	0.2165

Structure of the peroxisomal 3-ketoacyl-CoA thiolase from Sunflower

1. Protein Identity and Related Structures Protein Identity & Related Structures

ACETOACETYL COA THIOLASE

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2wua__assembly_1__model_1

2wua__assembly_1__model_1 | I(q)

2wua__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Structure of the peroxisomal 3-ketoacyl-CoA thiolase from Sunflower

1. Protein Identity and Related Structures Protein Identity & Related Structures

ACETOACETYL COA THIOLASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2wua__assembly_1__model_1

2wua__assembly_1__model_1 | I(q)

2wua__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (1)