2wy2

NMR structure of the IIAchitobiose-IIBchitobiose phosphoryl transition state complex of the N,N'-diacetylchitoboise brance of the E. coli phosphotransferase system.

Method: SOLUTION NMR

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

;N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIA COMPONENT ;

ESCHERICHIA COLI

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	;N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIB COMPONENT ; × 1 （C3T7F7） PHOSPHITE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PTQA_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–103； UniProt 14–116 Author chain B； PDBConstruct 1–103； UniProt 14–116 Author chain C； PDBConstruct 1–103； UniProt 14–116

;N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIB COMPONENT ;

ESCHERICHIA COLI

UniProt C3T7F7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	;N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIA COMPONENT ; × 3 （P69791） PHOSPHITE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C3T7F7_ECOLX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–103； UniProt 3–105

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2wy2
Deposition date deposition_date	2009-11-11
Structure title title	NMR structure of the IIAchitobiose-IIBchitobiose phosphoryl transition state complex of the N,N'-diacetylchitoboise brance of the E. coli phosphotransferase system.
Keywords keywords	KINASE, PHOSPHOTRANSFERASE SYSTEM, CHITOBIOSE, TRANSFERASE, SUGAR TRANSPORT; TRANSFERASE
Experimental Method method	SOLUTION NMR

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2wy2__assembly_1__model_40

Assembly 1 · Model 40 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2wy2__assembly_1__model_40 | I(q)

100 plotted points; both axes use logarithmic scales.

2wy2__assembly_1__model_40 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.42 Å
Rg (electron density)	22.57 Å
Total Rg	23.49 Å
Atom count	6432
Residues	412
Excluded volume	56738 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2wy2__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	2	`2wy2__assembly_1__model_2`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	3	`2wy2__assembly_1__model_3`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	4	`2wy2__assembly_1__model_4`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	5	`2wy2__assembly_1__model_5`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	6	`2wy2__assembly_1__model_6`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	7	`2wy2__assembly_1__model_7`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	8	`2wy2__assembly_1__model_8`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	9	`2wy2__assembly_1__model_9`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	10	`2wy2__assembly_1__model_10`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	11	`2wy2__assembly_1__model_11`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	12	`2wy2__assembly_1__model_12`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	13	`2wy2__assembly_1__model_13`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	14	`2wy2__assembly_1__model_14`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	15	`2wy2__assembly_1__model_15`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	16	`2wy2__assembly_1__model_16`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	17	`2wy2__assembly_1__model_17`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	18	`2wy2__assembly_1__model_18`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	19	`2wy2__assembly_1__model_19`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	20	`2wy2__assembly_1__model_20`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	21	`2wy2__assembly_1__model_21`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	22	`2wy2__assembly_1__model_22`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	23	`2wy2__assembly_1__model_23`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	24	`2wy2__assembly_1__model_24`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	25	`2wy2__assembly_1__model_25`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	26	`2wy2__assembly_1__model_26`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	27	`2wy2__assembly_1__model_27`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	28	`2wy2__assembly_1__model_28`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	29	`2wy2__assembly_1__model_29`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	30	`2wy2__assembly_1__model_30`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	31	`2wy2__assembly_1__model_31`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	32	`2wy2__assembly_1__model_32`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	33	`2wy2__assembly_1__model_33`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	34	`2wy2__assembly_1__model_34`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	35	`2wy2__assembly_1__model_35`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	36	`2wy2__assembly_1__model_36`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	37	`2wy2__assembly_1__model_37`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	38	`2wy2__assembly_1__model_38`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	39	`2wy2__assembly_1__model_39`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	40	`2wy2__assembly_1__model_40`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	41	`2wy2__assembly_1__model_41`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	42	`2wy2__assembly_1__model_42`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	43	`2wy2__assembly_1__model_43`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	44	`2wy2__assembly_1__model_44`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	45	`2wy2__assembly_1__model_45`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	46	`2wy2__assembly_1__model_46`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	47	`2wy2__assembly_1__model_47`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	48	`2wy2__assembly_1__model_48`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	49	`2wy2__assembly_1__model_49`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	50	`2wy2__assembly_1__model_50`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	51	`2wy2__assembly_1__model_51`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	52	`2wy2__assembly_1__model_52`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	53	`2wy2__assembly_1__model_53`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	54	`2wy2__assembly_1__model_54`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	55	`2wy2__assembly_1__model_55`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	56	`2wy2__assembly_1__model_56`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	57	`2wy2__assembly_1__model_57`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	58	`2wy2__assembly_1__model_58`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	59	`2wy2__assembly_1__model_59`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	60	`2wy2__assembly_1__model_60`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	61	`2wy2__assembly_1__model_61`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	62	`2wy2__assembly_1__model_62`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	63	`2wy2__assembly_1__model_63`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	64	`2wy2__assembly_1__model_64`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	;N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIA COMPONENT ;
Molecular weight formula_weight	11256.2 kDa
EC 编号 ec_number	2.7.1.-
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	411648

AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQLHLMTSMLARELITELIELHEKLKA

Source Source

Source organism organism	ESCHERICHIA COLI
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	ESCHERICHIA COLI BL21(DE3)

Entity 2 Entity 2 polymer

Description description	;N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIB COMPONENT ;
Molecular weight formula_weight	11065.1 kDa
EC 编号 ec_number	2.7.1.69
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

KKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Source Source

Source organism organism	ESCHERICHIA COLI
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	ESCHERICHIA COLI BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	PHOSPHITE ION
Molecular weight formula_weight	79.0 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	2wy2A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	80 — Phosphotransferase system, lactose/cellobiose-type IIA subunit

Domain ID domain_id	2wy2B00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	80 — Phosphotransferase system, lactose/cellobiose-type IIA subunit

Domain ID domain_id	2wy2C00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	80 — Phosphotransferase system, lactose/cellobiose-type IIA subunit

Domain ID domain_id	2wy2D00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	2300 — Response regulator

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

NMR structure of the IIAchitobiose-IIBchitobiose phosphoryl transition state complex of the N,N'-diacetylchitoboise brance of the E. coli phosphotransferase system.

1. Protein Identity and Related Structures Protein Identity & Related Structures

;N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIA COMPONENT ;

State in the Current Structure

Other States of the Same Protein in the Database

;N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIB COMPONENT ;

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2wy2__assembly_1__model_40

2wy2__assembly_1__model_40 | I(q)

2wy2__assembly_1__model_40 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (4)

NMR structure of the IIAchitobiose-IIBchitobiose phosphoryl transition state complex of the N,N'-diacetylchitoboise brance of the E. coli phosphotransferase system.

1. Protein Identity and Related Structures Protein Identity & Related Structures

;N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIA COMPONENT ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIB COMPONENT ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2wy2__assembly_1__model_40

2wy2__assembly_1__model_40 | I(q)

2wy2__assembly_1__model_40 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (4)