SAXSdb — 2wzr

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

POLYPROTEIN

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 240	No other associated polymer	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 4	No other associated polymer	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 20	No other associated polymer	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 24	No other associated polymer	Consistent with protein count
5	Protein homooligomer	Homooligomer	Protein 4	No other associated polymer	Consistent with protein count
6	Protein homooligomer	Homooligomer	Protein 240	No other associated polymer	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6PMU1_9PICO
Isoform	—
PDB entities	1, 2, 3, 4
Chains and sequence ranges	Author chain 1； PDBConstruct 1–219； UniProt 725–943 Author chain 2； PDBConstruct 1–219； UniProt 285–503 Author chain 3； PDBConstruct 1–221； UniProt 504–724 Author chain 4； PDBConstruct 1–85； UniProt 200–284

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2wzr
Deposition date deposition_date	2009-12-02
Structure title title	The Structure of Foot and Mouth Disease Virus Serotype SAT1
Keywords keywords	VIRUS, CAPSID, RNA REPLICATION, RNA-DIRECTED RNA POLYMERASE, NUCLEOTIDYLTRANSFERASE, HOST CYTOPLASMIC VESICLE, CAPSID PROTEIN; VIRUS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2wzr__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2wzr__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2wzr__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	132.50 Å
Total Rg	132.60 Å
Atom count	312600
Residues	40140
Excluded volume	5523600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2wzr__assembly_1__model_1`	240-MERIC （240）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2wzr__assembly_2__model_1`	tetrameric （4）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`2wzr__assembly_3__model_1`	eicosameric （20）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`2wzr__assembly_4__model_1`	24-meric （24）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`2wzr__assembly_5__model_1`	tetrameric （4）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
6	1	`2wzr__assembly_6__model_1`	240-meric （240）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	POLYPROTEIN
Molecular weight formula_weight	24161.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	5210

TTSAGEGADPVTTDASAHGGDTRTTRRAHTDVTFLLDRFTLVGKTNDNKLVLDLLSTKEKSLVGALLRAATYYFSDLEVACVGTNAWVGWTPNGSPVLTEVGDNPVVFSRRGTTRFALPYTAPHRVLATVYNGDCKYKPTGTAPRENIRGDLATLAARIASETHIPTTFNYGMIYTQAEVDVYLRMKRAELYCPRPVLTHYDHNGRDRYKTTLVKPAKQ

Entity 2 Entity 2 polymer

Description description	POLYPROTEIN
Molecular weight formula_weight	24623.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

DKKTEETTLLEDRIVTTSHGTTTSTTQSSVGVTYGYALTDKFLPGPNTNGLETRVEQAERFFKHKLFDWTLDQQFGTTYVLELPTDHKGIYGQLVDSHAYIRNGWDVQVSATATQFNGGCLLVAMVPELCKLDDREKYQLTLFPHQFLNPRTNTTAHIQVPYLGVDRHDQGTRHKAWTLVVMVLAPYTNDQTIGSTKAEVYVNIAPTNVYVAGEKPVKQ

Entity 3 Entity 3 polymer

Description description	POLYPROTEIN
Molecular weight formula_weight	24339.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

GILPVAVSDGYGGFQNTDPKTSDPVYGHVYNPARTLYPGRFTNLLDVAEACPTLLDFNGVPYVQTQSNSGSKVLACFDLAFGHKNMKNTYMSGLAQYFAQYSGTLNLHFMYTGPTNNKAKYMVAYIPPGTHPLPETPEMASHCYHAEWDTGLNSTFTFTVPYFSAADYAYTYADEPEQASVQGWVGVYQITDTHEKDGAVIVTVSAGPDFEFRMPISPSRQ

Entity 4 Entity 4 polymer

Description description	POLYPROTEIN
Molecular weight formula_weight	8784.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

GAGQSSPATGSQNQSGNTGSIINNYYMQQYQNSMDTQLGDNAISGGSNEGSTDTTSTHTNNTQNNDWFSKLAQSAFSGLVGALLA

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d2wzr1_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.0 — automated matches

Domain ID domain_id	d2wzr3_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.1 — Picornaviridae-like VP (VP1, VP2, VP3 and VP4)

CATH v4.4 (4 domains)

Domain ID domain_id	2wzr100
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2wzr200
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2wzr300
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2wzr400
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	90 — Foot-And-Mouth Disease Virus, subunit 4
Homologous superfamily homologous superfamily	10 — Capsid protein VP4 superfamily, Picornavirus

▶

Unit-cell length a length_a	305.140 Å
Unit-cell length b length_b	305.140 Å
Unit-cell length c length_c	723.670 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	180

Space group space_group	H 3
Space-group number int_tables_number	146
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	17.000 Å
R factor r_factor	0.2300
R_work r_work	0.2300
R_free r_free	—

The Structure of Foot and Mouth Disease Virus Serotype SAT1

1. Protein Identity and Related Structures Protein Identity & Related Structures

POLYPROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2wzr__assembly_1__model_1

2wzr__assembly_1__model_1 | I(q)

2wzr__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

CATH v4.4 (4 domains)

7. Citations (2)

The Structure of Foot and Mouth Disease Virus Serotype SAT1

1. Protein Identity and Related Structures Protein Identity & Related Structures

POLYPROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2wzr__assembly_1__model_1

2wzr__assembly_1__model_1 | I(q)

2wzr__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

CATH v4.4 (4 domains)

7. Citations (2)