SAXSdb — 2xpn

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

IWS1

ENCEPHALITOZOON CUNICULI

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	CHROMATIN STRUCTURE MODULATOR × 1 （Q8SRG7） BROMIDE ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8SUS7_ENCCU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–145； UniProt 55–198

CHROMATIN STRUCTURE MODULATOR

ENCEPHALITOZOON CUNICULI

UniProt Q8SRG7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	IWS1 × 1 （Q8SUS7） BROMIDE ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8SRG7_ENCCU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 5–23； UniProt 53–71

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2xpn
Deposition date deposition_date	2010-08-27
Structure title title	Crystal structure of a Spt6-Iws1(Spn1) complex from Encephalitozoon cuniculi, Form I
Keywords keywords	TRANSCRIPTION, ELONGATION, HISTONE CHAPERONE, RNA POLYMERASE II, MRNA EXPORT; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2xpn__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2xpn__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2xpn__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.87 Å
Rg (electron density)	15.58 Å
Total Rg	16.69 Å
Atom count	1270
Residues	158
Excluded volume	22935 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2xpn__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	IWS1
Molecular weight formula_weight	16424.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1402

MDPGTVLEISRSLKKRMQDILKKDNANNLEGRPATGKIENVEEISDILMSKALQESLLDEGILDEIKGWLEPLPDKSMPNIKIRKRLLDVLKTMKIHKEHLVTSGVGKIVYFYSINPKESKEVRASAKALVQKWTNEVFKPEGGD

Source Source

Source organism organism	ENCEPHALITOZOON CUNICULI
NCBI taxonomy ID ncbi_taxonomy_id	6035
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	CHROMATIN STRUCTURE MODULATOR
Molecular weight formula_weight	2712.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GSHMFFEIFGTGEEYRYVLESDP

Source Source

Source organism organism	ENCEPHALITOZOON CUNICULI
NCBI taxonomy ID ncbi_taxonomy_id	6035
Host organism host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 non-polymer

Description description	BROMIDE ION
Molecular weight formula_weight	79.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	132

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	2xpnA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	930 — Transcription Elongation Factor S-II; Chain A
Homologous superfamily homologous superfamily	10 — Conserved domain common to transcription factors TFIIS, elongin A, CRSP70

▶

Unit-cell length a length_a	52.311 Å
Unit-cell length b length_b	52.311 Å
Unit-cell length c length_c	151.125 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	1.950 Å
Low-resolution limit resolution_low	49.450 Å
R factor r_factor	0.2111
R_work r_work	0.2099
R_free r_free	0.2349

Crystal structure of a Spt6-Iws1(Spn1) complex from Encephalitozoon cuniculi, Form I

1. Protein Identity and Related Structures Protein Identity & Related Structures

IWS1

State in the Current Structure

Other States of the Same Protein in the Database

CHROMATIN STRUCTURE MODULATOR

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2xpn__assembly_1__model_1

2xpn__assembly_1__model_1 | I(q)

2xpn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)

Crystal structure of a Spt6-Iws1(Spn1) complex from Encephalitozoon cuniculi, Form I

1. Protein Identity and Related Structures Protein Identity & Related Structures

IWS1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CHROMATIN STRUCTURE MODULATOR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2xpn__assembly_1__model_1

2xpn__assembly_1__model_1 | I(q)

2xpn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)