SAXSdb — 2z0a

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nonstructural protein 1

Influenza A virus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	GLYCINE × 2 SUCCINIC ACID × 2 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	GLYCINE × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5H7I4_9INFA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 8–79； UniProt 1–72 Author chain B； PDBConstruct 8–79； UniProt 1–72 Author chain C； PDBConstruct 8–79； UniProt 1–72 Author chain D； PDBConstruct 8–79； UniProt 1–72

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2z0a
Deposition date deposition_date	2007-05-07
Structure title title	Crystal structure of RNA-binding domain of NS1 from influenza A virus A/crow/Kyoto/T1/2004(H5N1)
Keywords keywords	;avian influenza, H5N1, RNA-binding, NS1, VIRAL PROTEIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI ;; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2z0a__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2z0a__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2z0a__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.95 Å
Rg (electron density)	14.56 Å
Total Rg	15.76 Å
Atom count	1172
Residues	144
Excluded volume	20568 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2z0a__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2z0a__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Nonstructural protein 1
Molecular weight formula_weight	8844.9 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	2653

GSSGSSGMDPNTVSSFQVDCFLWHVRKRLADQELGDAPFLDRLRRDQKSLRGRGNTLGLDIETATRAGKQIVERILEEE

Source Source

Source organism organism	Influenza A virus
NCBI taxonomy ID ncbi_taxonomy_id	11320
Host organism host_organism	Cell-free protein synthesis

Entity 2 Entity 2 non-polymer

Description description	GLYCINE
Molecular weight formula_weight	75.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 non-polymer

Description description	SUCCINIC ACID
Molecular weight formula_weight	118.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	286

▼

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (5 domains)

Domain ID domain_id	d2z0aa_
Class class	a — All alpha proteins
Fold Fold fold	a.16 — S15/NS1 RNA-binding domain
Superfamily Superfamily superfamily	a.16.1 — S15/NS1 RNA-binding domain
Family Family family	a.16.1.1 — N-terminal, RNA-binding domain of nonstructural protein NS1

Domain ID domain_id	d2z0ab_
Class class	a — All alpha proteins
Fold Fold fold	a.16 — S15/NS1 RNA-binding domain
Superfamily Superfamily superfamily	a.16.1 — S15/NS1 RNA-binding domain
Family Family family	a.16.1.1 — N-terminal, RNA-binding domain of nonstructural protein NS1

Domain ID domain_id	d2z0ac1
Class class	a — All alpha proteins
Fold Fold fold	a.16 — S15/NS1 RNA-binding domain
Superfamily Superfamily superfamily	a.16.1 — S15/NS1 RNA-binding domain
Family Family family	a.16.1.1 — N-terminal, RNA-binding domain of nonstructural protein NS1

Domain ID domain_id	d2z0ac2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2z0ad_
Class class	a — All alpha proteins
Fold Fold fold	a.16 — S15/NS1 RNA-binding domain
Superfamily Superfamily superfamily	a.16.1 — S15/NS1 RNA-binding domain
Family Family family	a.16.1.1 — N-terminal, RNA-binding domain of nonstructural protein NS1

CATH v4.4 (4 domains)

Domain ID domain_id	2z0aA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	10 — S15/NS1, RNA-binding

Domain ID domain_id	2z0aB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	10 — S15/NS1, RNA-binding

Domain ID domain_id	2z0aC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	10 — S15/NS1, RNA-binding

Domain ID domain_id	2z0aD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	10 — S15/NS1, RNA-binding

▶

Unit-cell length a length_a	37.723 Å
Unit-cell length b length_b	54.378 Å
Unit-cell length c length_c	66.347 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	100.57 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.850 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.1758
R_work r_work	0.1725
R_free r_free	0.2383

Crystal structure of RNA-binding domain of NS1 from influenza A virus A/crow/Kyoto/T1/2004(H5N1)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nonstructural protein 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2z0a__assembly_2__model_1

2z0a__assembly_2__model_1 | I(q)

2z0a__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (5 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of RNA-binding domain of NS1 from influenza A virus A/crow/Kyoto/T1/2004(H5N1)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nonstructural protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2z0a__assembly_2__model_1

2z0a__assembly_2__model_1 | I(q)

2z0a__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (5 domains)

CATH v4.4 (4 domains)

7. Citations (1)