SAXSdb — 2z39

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chitinase

Brassica juncea

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	CHLORIDE ION × 8 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	CHLORIDE ION × 11 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9SQF7_BRAJU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–246； UniProt 146–389 Author chain B； PDBConstruct 3–246； UniProt 146–389

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2z39
Deposition date deposition_date	2007-06-02
Structure title title	Crystal structure of Brassica juncea chitinase catalytic module Glu234Ala mutant (Bjchi3-E234A)
Keywords keywords	chitinase, endochitinase, family 19, conformational changes, HYDROLASE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2z39__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2z39__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2z39__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.22 Å
Rg (electron density)	17.06 Å
Total Rg	18.06 Å
Atom count	1919
Residues	246
Excluded volume	33711 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2z39__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2z39__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Chitinase
Molecular weight formula_weight	27200.4 kDa
EC 编号 ec_number	3.2.1.14
Mutation mutation	E234A
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4265

FGDLSGIISRDQFYKMLKHMNDNDCHAVGFFTYDAFITAAKSFPSFGNTGDLAMRKKEIAAFFGQTSHETTGGWSGAPDGANTWGYCYKEAIDKSDPHCDSNNLEWPCAPGKFYYGRGPMMLSWNYNYGPCGRDLGLELLKNPDVASSDPVIAFKTAIWFWMTPQAPKPSCHDVITDQWEPSAADISAGRLPGYGVITNIINGGLECAGRDVAKVQDRISFYTRYCGMFGVDPGSNIDCDNQRPFN

Source Source

Source organism organism	Brassica juncea
NCBI taxonomy ID ncbi_taxonomy_id	3707
Host organism host_organism	Pichia pastoris

Entity 2 Entity 2 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	19

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	421

▼

6. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d2z39a1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.2 — Lysozyme-like
Superfamily Superfamily superfamily	d.2.1 — Lysozyme-like
Family Family family	d.2.1.1 — Family 19 glycosidase

Domain ID domain_id	d2z39a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2z39b_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.2 — Lysozyme-like
Superfamily Superfamily superfamily	d.2.1 — Lysozyme-like
Family Family family	d.2.1.1 — Family 19 glycosidase

CATH v4.4 (4 domains)

Domain ID domain_id	2z39A01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	530 — Lysozyme
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	2z39A02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	20 — Endochitinase; domain 2
Homologous superfamily homologous superfamily	10 — Endochitinase, domain 2

Domain ID domain_id	2z39B01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	530 — Lysozyme
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	2z39B02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	20 — Endochitinase; domain 2
Homologous superfamily homologous superfamily	10 — Endochitinase, domain 2

▶

Unit-cell length a length_a	60.988 Å
Unit-cell length b length_b	47.254 Å
Unit-cell length c length_c	77.668 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	100.85 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.700 Å
Low-resolution limit resolution_low	37.100 Å
R factor r_factor	0.1800
R_work r_work	0.1780
R_free r_free	0.2220

Crystal structure of Brassica juncea chitinase catalytic module Glu234Ala mutant (Bjchi3-E234A)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chitinase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2z39__assembly_1__model_1

2z39__assembly_1__model_1 | I(q)

2z39__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (3 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of Brassica juncea chitinase catalytic module Glu234Ala mutant (Bjchi3-E234A)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chitinase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2z39__assembly_1__model_1

2z39__assembly_1__model_1 | I(q)

2z39__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (3 domains)

CATH v4.4 (4 domains)

7. Citations (1)