SAXSdb — 2zf9

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ScaE cell-surface anchored scaffoldin protein

Ruminococcus flavefaciens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	GLYCEROL × 1 CHLORIDE ION × 1 water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
4	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4A3Y2_RUMFL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 11–192； UniProt 30–211 Author chain B； PDBConstruct 11–192； UniProt 30–211 Author chain C； PDBConstruct 11–192； UniProt 30–211 Author chain D； PDBConstruct 11–192； UniProt 30–211

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2zf9
Deposition date deposition_date	2007-12-26
Structure title title	Crystal structure of a type III cohesin module from the cellulosomal ScaE cell-surface anchoring scaffoldin of Ruminococcus flavefaciens
Keywords keywords	Dockerin-binding module, anchoring module, alpha helix, beta flaps, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2zf9__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2zf9__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2zf9__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	17.50 Å
Rg (electron density)	16.47 Å
Total Rg	17.45 Å
Atom count	1349
Residues	177
Excluded volume	23906 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2zf9__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2zf9__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2zf9__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2zf9__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	ScaE cell-surface anchored scaffoldin protein
Molecular weight formula_weight	21042.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	6343

MTHHHHHHAMGPAAGQAYDAGNLDVASSPVKPTLSITKKTLTAAEAPNAKVTMELSVEGAADKYAATGLHIQFDPKLKLIPDEDGALATAGRAARLLELKKAEADTDNSFFTATGSSTNNGKDGVLWSFVLQVPADAQPGDKYDVQVAYQSRTTNEDLFTNVKKDEEGLLMQAWTFTQGIEQGYIQVESTTSLE

Source Source

Source organism organism	Ruminococcus flavefaciens
NCBI taxonomy ID ncbi_taxonomy_id	1265
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	880

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	2zf9A00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	680 —

Domain ID domain_id	2zf9B00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	680 —

Domain ID domain_id	2zf9C00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	680 —

Domain ID domain_id	2zf9D00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	680 —

▶

Unit-cell length a length_a	155.560 Å
Unit-cell length b length_b	69.250 Å
Unit-cell length c length_c	93.030 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	123.37 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	1.950 Å
Low-resolution limit resolution_low	23.690 Å
R factor r_factor	0.1641
R_work r_work	0.1616
R_free r_free	0.2112

Crystal structure of a type III cohesin module from the cellulosomal ScaE cell-surface anchoring scaffoldin of Ruminococcus flavefaciens

1. Protein Identity and Related Structures Protein Identity & Related Structures

ScaE cell-surface anchored scaffoldin protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2zf9__assembly_3__model_1

2zf9__assembly_3__model_1 | I(q)

2zf9__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (2)

Crystal structure of a type III cohesin module from the cellulosomal ScaE cell-surface anchoring scaffoldin of Ruminococcus flavefaciens

1. Protein Identity and Related Structures Protein Identity & Related Structures

ScaE cell-surface anchored scaffoldin protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2zf9__assembly_3__model_1

2zf9__assembly_3__model_1 | I(q)

2zf9__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (2)