SAXSdb — 35yt

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phosphate-binding protein PstS

Xanthomonas citri subsp. citri 306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	PHOSPHATE ION × 10 IODIDE ION × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	PHOSPHATE ION × 8	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	PHOSPHATE ION × 6 IODIDE ION × 1	Consistent with protein count
4	Protein monomer	Monomer	Protein 1	PHOSPHATE ION × 7 IODIDE ION × 1 water × 1	Consistent with protein count
5	Protein monomer	Monomer	Protein 1	PHOSPHATE ION × 7 water × 1	Consistent with protein count
6	Protein monomer	Monomer	Protein 1	PHOSPHATE ION × 8 water × 1	Consistent with protein count
7	Protein monomer	Monomer	Protein 1	PHOSPHATE ION × 6 water × 1	Consistent with protein count
8	Protein monomer	Monomer	Protein 1	PHOSPHATE ION × 9 IODIDE ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0AAI8ERC0_XANAC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 21–335； UniProt 25–339 Author chain B； PDBConstruct 21–335； UniProt 25–339 Author chain C； PDBConstruct 21–335； UniProt 25–339 Author chain D； PDBConstruct 21–335； UniProt 25–339 Author chain E； PDBConstruct 21–335； UniProt 25–339 Author chain F； PDBConstruct 21–335； UniProt 25–339 Author chain G； PDBConstruct 21–335； UniProt 25–339 Author chain H； PDBConstruct 21–335； UniProt 25–339

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	35yt
Deposition date deposition_date	2026-05-23
Last revision last_revision	2026-06-10
Structure title title	Re-refined Phosphate-Binding Protein (PstS2) from Xanthomonas citri pv. citri A306 Bound to Phosphate
Keywords keywords	SBP, ABC Transporter, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

35yt__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

35yt__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

35yt__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.42 Å
Rg (electron density)	19.46 Å
Total Rg	20.52 Å
Atom count	4679
Residues	313
Excluded volume	41987 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`35yt__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`35yt__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`35yt__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`35yt__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`35yt__assembly_5__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`35yt__assembly_6__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`35yt__assembly_7__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`35yt__assembly_8__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Phosphate-binding protein PstS
Molecular weight formula_weight	35364.9 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H
Atom count atom_count	37540

MGSSHHHHHSSGLVPRGSHMADVTGAGASFIYPVMSKWSADYNAATKKQVNYQSIGSGGGIAQIKAASVDFGSSDAPLKPEELAAAGLAQFPSVIGGVVPVVNVPGIAAGTLKLDGKTLGDIFLGKVSTWNDPAIAALNPGVKLPEGKITVVHRSDGSGTSFNFTNYLSKVNPDWKGKVGEGTAVQWPTGIGGKGNEGVAAYVKQIKGGIGYVELSYALQNKMAYTAMKNAAGKFVQPSDETFAAAANSADWGTAKDFYLVMTNAAGDNAWPITATNFILVQKKPKNPAGLKNTLEFFRWVYTKGDAQAKQLDYVPLPDTLVTQIEAYWAKNLPH

Source Source

Source organism organism	Xanthomonas citri subsp. citri 306
NCBI taxonomy ID ncbi_taxonomy_id	1203463
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	61

Entity 3 Entity 3 non-polymer

Description description	IODIDE ION
Molecular weight formula_weight	126.9 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	7

▶

Unit-cell length a length_a	81.556 Å
Unit-cell length b length_b	115.643 Å
Unit-cell length c length_c	133.323 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.33 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	monoclinic

Resolution resolution	2.980 Å
Low-resolution limit resolution_low	17.060 Å
R factor r_factor	0.2515
R_work r_work	0.2503
R_free r_free	0.2733

Re-refined Phosphate-Binding Protein (PstS2) from Xanthomonas citri pv. citri A306 Bound to Phosphate

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phosphate-binding protein PstS

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

35yt__assembly_3__model_1

35yt__assembly_3__model_1 | I(q)

35yt__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (3)

Re-refined Phosphate-Binding Protein (PstS2) from Xanthomonas citri pv. citri A306 Bound to Phosphate

1. Protein Identity and Related Structures Protein Identity & Related Structures

Phosphate-binding protein PstS

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

35yt__assembly_3__model_1

35yt__assembly_3__model_1 | I(q)

35yt__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (3)