SAXSdb — 3a59

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hemoglobin subunit alpha-A

OrganismNot specified

UniProt P01981

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Hemoglobin subunit beta × 1 （P02123） PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Hemoglobin subunit beta × 1 （P02123） PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Hemoglobin subunit beta × 1 （P02123） PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Hemoglobin subunit beta × 1 （P02123） PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 4	Hemoglobin subunit beta × 2 （P02123） PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 4	Hemoglobin subunit beta × 2 （P02123） PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HBA_STRCA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–141； UniProt 1–141 Author chain C； PDBConstruct 1–141； UniProt 1–141 Author chain E； PDBConstruct 1–141； UniProt 1–141 Author chain G； PDBConstruct 1–141； UniProt 1–141

Hemoglobin subunit beta

OrganismNot specified

UniProt P02123

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Hemoglobin subunit alpha-A × 1 （P01981） PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Hemoglobin subunit alpha-A × 1 （P01981） PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Hemoglobin subunit alpha-A × 1 （P01981） PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Hemoglobin subunit alpha-A × 1 （P01981） PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 4	Hemoglobin subunit alpha-A × 2 （P01981） PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 4	Hemoglobin subunit alpha-A × 2 （P01981） PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HBB_STRCA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–146； UniProt 1–146 Author chain D； PDBConstruct 1–146； UniProt 1–146 Author chain F； PDBConstruct 1–146； UniProt 1–146 Author chain H； PDBConstruct 1–146； UniProt 1–146

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3a59
Deposition date deposition_date	2009-08-03
Structure title title	Structure of Hemoglobin from flightless bird (Struthio camelus)
Keywords keywords	Ostrich, Struthio camelus, Hemoglobin, Heme, Iron, Metal-binding, Oxygen transport, Polymorphism, Transport, OXYGEN STORAGE; OXYGEN STORAGE, OXYGEN TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3a59__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3a59__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3a59__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.59 Å
Rg (electron density)	19.29 Å
Total Rg	20.23 Å
Atom count	2328
Residues	287
Excluded volume	41839 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3a59__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3a59__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3a59__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`3a59__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`3a59__assembly_5__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`3a59__assembly_6__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Hemoglobin subunit alpha-A
Molecular weight formula_weight	15470.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G
Atom count atom_count	9314

VLSGTDKTNVKGIFSKISSHAEEYGAETLERMFITYPQTKTYFPHFDLHHGSAQIKAHGKKVANALIEAVNHIDDISGALSKLSDLHAQKLRVDPVNFKLLGQCFLVVVAIHHPSALTPEVHASLDKFLCAVGAVLTAKYR

Entity 2 Entity 2 polymer

Description description	Hemoglobin subunit beta
Molecular weight formula_weight	16317.9 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H

VQWSAEEKQLISGLWGKVNVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKKVLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFTKEFTPECQAAWQKLVRVVAHALARKYH

Entity 3 Entity 3 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	8

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	3a59A00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	3a59B00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	3a59C00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	3a59D00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	3a59E00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	3a59F00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	3a59G00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	3a59H00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

▶

Unit-cell length a length_a	82.051 Å
Unit-cell length b length_b	82.051 Å
Unit-cell length c length_c	214.928 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 41
Space-group number int_tables_number	76
Crystal system crystal_system	—

Resolution resolution	3.410 Å
Low-resolution limit resolution_low	28.750 Å
R factor r_factor	0.2748
R_work r_work	0.2654
R_free r_free	0.3537

Structure of Hemoglobin from flightless bird (Struthio camelus)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hemoglobin subunit alpha-A

State in the Current Structure

Other States of the Same Protein in the Database

Hemoglobin subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3a59__assembly_2__model_1

3a59__assembly_2__model_1 | I(q)

3a59__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)

Structure of Hemoglobin from flightless bird (Struthio camelus)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hemoglobin subunit alpha-A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Hemoglobin subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3a59__assembly_2__model_1

3a59__assembly_2__model_1 | I(q)

3a59__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)