SAXSdb — 3aqj

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Baseplate assembly protein V

Enterobacteria phage P2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 3	FE (II) ION × 1 CHLORIDE ION × 1 CALCIUM ION × 1 water × 3	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 3	FE (II) ION × 1 CHLORIDE ION × 1 CALCIUM ION × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VPV_BPP2
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 10–134； UniProt 87–211 Author chain B； PDBConstruct 10–134； UniProt 87–211 Author chain C； PDBConstruct 10–134； UniProt 87–211 Author chain P； PDBConstruct 10–134； UniProt 87–211 Author chain Q； PDBConstruct 10–134； UniProt 87–211 Author chain R； PDBConstruct 10–134； UniProt 87–211

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3aqj
Deposition date deposition_date	2010-11-06
Structure title title	Crystal Structure of a C-terminal domain of the bacteriophage P2 tail spike protein, gpV
Keywords keywords	bacteriophage, tail spike, iron binding, beta-helix, infection, METAL BINDING PROTEIN; METAL BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3aqj__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3aqj__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3aqj__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	26.23 Å
Rg (electron density)	25.78 Å
Total Rg	26.06 Å
Atom count	2492
Residues	347
Excluded volume	44129 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3aqj__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3aqj__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Baseplate assembly protein V
Molecular weight formula_weight	13957.5 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,P,Q,R
Atom count atom_count	6102

MHHHHHHHHSGDNPSPSVSADALHIRFPDGAVIEYEPETSALTVSGIKTASVTASGSVTATVPVVMVKASTRVTLDTPEVVCTNRLITGTLEVQKGGTMRGNIEHTGGELSSNGKVLHTHKHPGDSGGTTGSPL

Source Source

Source organism organism	Enterobacteria phage P2
Common name common_name	Bacteriophage P2
NCBI taxonomy ID ncbi_taxonomy_id	10679
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	FE (II) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	896

▶

Unit-cell length a length_a	66.912 Å
Unit-cell length b length_b	64.463 Å
Unit-cell length c length_c	67.186 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	91.32 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.270 Å
Low-resolution limit resolution_low	46.420 Å
R factor r_factor	0.1615
R_work r_work	0.1600
R_free r_free	0.1905

Crystal Structure of a C-terminal domain of the bacteriophage P2 tail spike protein, gpV

1. Protein Identity and Related Structures Protein Identity & Related Structures

Baseplate assembly protein V

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3aqj__assembly_2__model_1

3aqj__assembly_2__model_1 | I(q)

3aqj__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

Crystal Structure of a C-terminal domain of the bacteriophage P2 tail spike protein, gpV

1. Protein Identity and Related Structures Protein Identity & Related Structures

Baseplate assembly protein V

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3aqj__assembly_2__model_1

3aqj__assembly_2__model_1 | I(q)

3aqj__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)