SAXSdb — 3bge

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Predicted ATPase

Haemophilus influenzae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 8	SULFATE ION × 12 water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4QL22_HAEI8
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–193； UniProt 251–440 Author chain B； PDBConstruct 4–193； UniProt 251–440

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3bge
Deposition date deposition_date	2007-11-26
Structure title title	Crystal structure of the C-terminal fragment of AAA+ATPase from Haemophilus influenzae
Keywords keywords	;structural genomics, Predicted AAA+ATPase C-terminal fragment, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ATP-binding, Helicase, Nucleotide-binding, NUCLEOTIDE BINDING PROTEIN ;; NUCLEOTIDE BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3bge__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3bge__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3bge__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	31.94 Å
Rg (electron density)	30.66 Å
Total Rg	31.36 Å
Atom count	10372
Residues	1304
Excluded volume	183740 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3bge__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Predicted ATPase
Molecular weight formula_weight	22674.4 kDa
Mutation mutation	A340S
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2855

MSLGDRFYDLISALHKSVRGSAPDAALYWYARILTAGGDPLYVARRLLAIASEDVGNADPRAMQVALAAWDCFTRVGAYEGERAIAQAIIYLSVAPKSNAVYTAFNTAKQQAKDLPDYDVPPHLRNAPTNLMKELGYGAEYRYAHDEPNAYAAGENYFPPELKDTQYYFPTNRGMEIQIKEKLERLREQDKSTEGHHHHHH

Source Source

Source organism organism	Haemophilus influenzae
NCBI taxonomy ID ncbi_taxonomy_id	281310
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	220

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d3bgea1
Class class	a — All alpha proteins
Fold Fold fold	a.80 — post-AAA+ oligomerization domain-like
Superfamily Superfamily superfamily	a.80.1 — post-AAA+ oligomerization domain-like
Family Family family	a.80.1.2 — MgsA/YrvN C-terminal domain-like

Domain ID domain_id	d3bgeb_
Class class	a — All alpha proteins
Fold Fold fold	a.80 — post-AAA+ oligomerization domain-like
Superfamily Superfamily superfamily	a.80.1 — post-AAA+ oligomerization domain-like
Family Family family	a.80.1.2 — MgsA/YrvN C-terminal domain-like

CATH v4.4 (4 domains)

Domain ID domain_id	3bgeA01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	272 — Zinc Finger, Delta Prime; domain 3
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3bgeA02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3710 — post-AAA+ oligomerization domain-like
Homologous superfamily homologous superfamily	10 — DNA polymerase III clamp loader subunits, C-terminal domain

Domain ID domain_id	3bgeB01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	272 — Zinc Finger, Delta Prime; domain 3
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3bgeB02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3710 — post-AAA+ oligomerization domain-like
Homologous superfamily homologous superfamily	10 — DNA polymerase III clamp loader subunits, C-terminal domain

▶

Unit-cell length a length_a	93.085 Å
Unit-cell length b length_b	93.085 Å
Unit-cell length c length_c	83.413 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	I 4
Space-group number int_tables_number	79
Crystal system crystal_system	—

Resolution resolution	1.850 Å
Low-resolution limit resolution_low	23.120 Å
R factor r_factor	0.1890
R_work r_work	0.1870
R_free r_free	0.2400

Crystal structure of the C-terminal fragment of AAA+ATPase from Haemophilus influenzae

1. Protein Identity and Related Structures Protein Identity & Related Structures

Predicted ATPase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3bge__assembly_1__model_1

3bge__assembly_1__model_1 | I(q)

3bge__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of the C-terminal fragment of AAA+ATPase from Haemophilus influenzae

1. Protein Identity and Related Structures Protein Identity & Related Structures

Predicted ATPase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3bge__assembly_1__model_1

3bge__assembly_1__model_1 | I(q)

3bge__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

CATH v4.4 (4 domains)

7. Citations (1)