SAXSdb — 3c03

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

EscU

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	PROLINE × 1 water × 1	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9AJ26_ECOLX
Isoform	—
PDB entities	1, 2, 3
Chains and sequence ranges	Author chain A； PDBConstruct 7–137； UniProt 215–345 Author chain B； PDBConstruct 7–54； UniProt 215–262 Author chain C； PDBConstruct 1–83； UniProt 263–345

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3c03
Deposition date deposition_date	2008-01-18
Structure title title	Crystal structure of the EscU C-terminal domain with P263A mutation,space group P 1 21 1
Keywords keywords	Auto cleavage protein, intein succinimid, Asparagine cyclization, flagella, T3SS, MEMBRANE PROTEIN, PROTEIN TRANSPORT; MEMBRANE PROTEIN, PROTEIN TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3c03__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3c03__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3c03__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	14.05 Å
Rg (electron density)	12.48 Å
Total Rg	13.97 Å
Atom count	772
Residues	97
Excluded volume	14150 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3c03__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3c03__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	EscU
Molecular weight formula_weight	15427.8 kDa
Mutation mutation	P263A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1636

GSHMASMSKDEVKREAKDTDGNPEIKGERRRLHSEIQSGSLANNIKKSTVIVKNATHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAIDLDY

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	EscU
Molecular weight formula_weight	5973.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GSHMASMSKDEVKREAKDTDGNPEIKGERRRLHSEIQSGSLANNIKKSTVIVKN

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	EscU
Molecular weight formula_weight	9454.0 kDa
Mutation mutation	P263A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

ATHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAIDLDY

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 non-polymer

Description description	PROLINE
Molecular weight formula_weight	115.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	63

▼

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d3c03a_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.367 — EscU C-terminal domain-like
Superfamily Superfamily superfamily	d.367.1 — EscU C-terminal domain-like
Family Family family	d.367.1.1 — EscU C-terminal domain-like

CATH v4.4 (2 domains)

Domain ID domain_id	3c03A00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1690 — name from scop
Homologous superfamily homologous superfamily	10 — secretion proteins EscU

Domain ID domain_id	3c03C00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1690 — name from scop
Homologous superfamily homologous superfamily	10 — secretion proteins EscU

▶

Unit-cell length a length_a	36.111 Å
Unit-cell length b length_b	55.478 Å
Unit-cell length c length_c	50.448 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	108.69 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	16.000 Å
R factor r_factor	0.1760
R_work r_work	0.1730
R_free r_free	0.2390

Crystal structure of the EscU C-terminal domain with P263A mutation,space group P 1 21 1

1. Protein Identity and Related Structures Protein Identity & Related Structures

EscU

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3c03__assembly_2__model_1

3c03__assembly_2__model_1 | I(q)

3c03__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (1 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Crystal structure of the EscU C-terminal domain with P263A mutation,space group P 1 21 1

1. Protein Identity and Related Structures Protein Identity & Related Structures

EscU

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3c03__assembly_2__model_1

3c03__assembly_2__model_1 | I(q)

3c03__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (1 domains)

CATH v4.4 (2 domains)

7. Citations (1)