SAXSdb — 3c05

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Disintegrin acostatin alpha

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Disintegrin acostatin-beta × 1 （Q805F6） SULFATE ION × 3 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Disintegrin acostatin-beta × 1 （Q805F6） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DISA_AGKCO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–62； UniProt 48–109 Author chain C； PDBConstruct 1–62； UniProt 48–109

Disintegrin acostatin-beta

OrganismNot specified

UniProt Q805F6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Disintegrin acostatin alpha × 1 （Q805F7） SULFATE ION × 3 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Disintegrin acostatin alpha × 1 （Q805F7） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DISB_AGKCO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–64； UniProt 419–482 Author chain D； PDBConstruct 1–64； UniProt 419–482

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3c05
Deposition date deposition_date	2008-01-18
Structure title title	Crystal structure of Acostatin from Agkistrodon Contortrix Contortrix
Keywords keywords	;beta-sheets, disulfide bridges, Blood coagulation, Cell adhesion, Secreted, Hydrolase, Metal-binding, Metalloprotease, Protease, Zinc, Zymogen, BLOOD CLOTTING-ANTITUMOR PROTEIN COMPLEX ;; BLOOD CLOTTING/ANTITUMOR PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3c05__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3c05__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3c05__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.51 Å
Rg (electron density)	20.25 Å
Total Rg	20.64 Å
Atom count	824
Residues	114
Excluded volume	14270 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3c05__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3c05__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Disintegrin acostatin alpha
Molecular weight formula_weight	6747.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	2004

QPKNPCCDAATCKLTPGSQCAEGLCCDQCKFIKAGKICRRARGDNPDYRCTGQSGDCPRKHF

Entity 2 Entity 2 polymer

Description description	Disintegrin acostatin-beta
Molecular weight formula_weight	6799.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

DAPANPCCDAATCKLTTGSQCADGLCCDQCKFMKEGTVCRRARGDDLDDYCNGISAGCPRNPFH

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	303

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d3c05a_
Class class	g — Small proteins
Fold Fold fold	g.20 — Blood coagulation inhibitor (disintegrin)
Superfamily Superfamily superfamily	g.20.1 — Blood coagulation inhibitor (disintegrin)
Family Family family	g.20.1.1 — Blood coagulation inhibitor (disintegrin)

Domain ID domain_id	d3c05b_
Class class	g — Small proteins
Fold Fold fold	g.20 — Blood coagulation inhibitor (disintegrin)
Superfamily Superfamily superfamily	g.20.1 — Blood coagulation inhibitor (disintegrin)
Family Family family	g.20.1.1 — Blood coagulation inhibitor (disintegrin)

Domain ID domain_id	d3c05c_
Class class	g — Small proteins
Fold Fold fold	g.20 — Blood coagulation inhibitor (disintegrin)
Superfamily Superfamily superfamily	g.20.1 — Blood coagulation inhibitor (disintegrin)
Family Family family	g.20.1.1 — Blood coagulation inhibitor (disintegrin)

Domain ID domain_id	d3c05d_
Class class	g — Small proteins
Fold Fold fold	g.20 — Blood coagulation inhibitor (disintegrin)
Superfamily Superfamily superfamily	g.20.1 — Blood coagulation inhibitor (disintegrin)
Family Family family	g.20.1.1 — Blood coagulation inhibitor (disintegrin)

CATH v4.4 (4 domains)

Domain ID domain_id	3c05A00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	70 — Echistatin
Homologous superfamily homologous superfamily	10 — Disintegrin domain

Domain ID domain_id	3c05B00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	70 — Echistatin
Homologous superfamily homologous superfamily	10 — Disintegrin domain

Domain ID domain_id	3c05C00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	70 — Echistatin
Homologous superfamily homologous superfamily	10 — Disintegrin domain

Domain ID domain_id	3c05D00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	70 — Echistatin
Homologous superfamily homologous superfamily	10 — Disintegrin domain

▶

Unit-cell length a length_a	37.449 Å
Unit-cell length b length_b	59.808 Å
Unit-cell length c length_c	121.307 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.700 Å
Low-resolution limit resolution_low	19.670 Å
R factor r_factor	0.1880
R_work r_work	0.1860
R_free r_free	0.2150

Crystal structure of Acostatin from Agkistrodon Contortrix Contortrix

1. Protein Identity and Related Structures Protein Identity & Related Structures

Disintegrin acostatin alpha

State in the Current Structure

Other States of the Same Protein in the Database

Disintegrin acostatin-beta

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3c05__assembly_2__model_1

3c05__assembly_2__model_1 | I(q)

3c05__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of Acostatin from Agkistrodon Contortrix Contortrix

1. Protein Identity and Related Structures Protein Identity & Related Structures

Disintegrin acostatin alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Disintegrin acostatin-beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3c05__assembly_2__model_1

3c05__assembly_2__model_1 | I(q)

3c05__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)