SAXSdb — 3c9a

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein giant-lens

Drosophila melanogaster

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Protein spitz × 1 （Q01083） BROMIDE ION × 8 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Protein spitz × 1 （Q01083） BROMIDE ION × 10 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GIL_DROME
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–53； UniProt 113–165 Author chain A； PDBConstruct 58–217； UniProt 285–444 Author chain B； PDBConstruct 1–53； UniProt 113–165 Author chain B； PDBConstruct 58–217； UniProt 285–444

Protein spitz

Drosophila melanogaster

UniProt Q01083

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Protein giant-lens × 1 （Q00805） BROMIDE ION × 8 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Protein giant-lens × 1 （Q00805） BROMIDE ION × 10 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPITZ_DROME
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–52； UniProt 76–127 Author chain D； PDBConstruct 1–52； UniProt 76–127

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3c9a
Deposition date deposition_date	2008-02-15
Structure title title	High Resolution Crystal Structure of Argos bound to the EGF domain of Spitz
Keywords keywords	;Argos, Spitz, EGF, EGFR inhibitor, inhibitor, Developmental protein, Glycoprotein, Secreted, Sensory transduction, Vision, Differentiation, EGF-like domain, Endoplasmic reticulum, Golgi apparatus, Membrane, Neurogenesis, Transmembrane, HORMONE-SIGNALING PROTEIN COMPLEX ;; HORMONE/SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3c9a__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3c9a__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3c9a__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.65 Å
Rg (electron density)	18.42 Å
Total Rg	19.42 Å
Atom count	2048
Residues	255
Excluded volume	36149 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3c9a__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3c9a__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Protein giant-lens
Molecular weight formula_weight	25619.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4966

RSIIGGKHGDRDVRILYQVGDSEEDLPVCAPNAVCSKIDLYETPWIERQCRCPDGRTCPSSLGVEDGHTIADKTRHYKMCQPVHKLPVCKHFRDYTWTLTTAAELNVTEQIVHCRCPRNSVTYLTKREPIGNDSPGYRYLFACSPLTRLRCQRKQPCKLFTVRKRQEFLDEVNINSLCQCPKGHRCPSHHTQSGVIAGESFLEDNIQTYSGYCMANDHHHHHH

Source Source

Source organism organism	Drosophila melanogaster
Common name common_name	Fruit fly
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	Protein spitz
Molecular weight formula_weight	6012.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

TFPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQRCEYKEID

Source Source

Source organism organism	Drosophila melanogaster
Common name common_name	Fruit fly
Host organism host_organism	Drosophila melanogaster

Entity 3 Entity 3 non-polymer

Description description	BROMIDE ION
Molecular weight formula_weight	79.9 kDa
Source method src_method	syn
Copy count entity_count	18

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	860

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	3c9aA01
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	20 — Anthopleurin-A
Homologous superfamily homologous superfamily	160 —

Domain ID domain_id	3c9aA02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	20 — Anthopleurin-A
Homologous superfamily homologous superfamily	150 —

Domain ID domain_id	3c9aA03
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	20 — Anthopleurin-A
Homologous superfamily homologous superfamily	160 —

Domain ID domain_id	3c9aB01
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	20 — Anthopleurin-A
Homologous superfamily homologous superfamily	160 —

Domain ID domain_id	3c9aB02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	20 — Anthopleurin-A
Homologous superfamily homologous superfamily	150 —

Domain ID domain_id	3c9aB03
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	20 — Anthopleurin-A
Homologous superfamily homologous superfamily	160 —

Domain ID domain_id	3c9aC00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	25 — Laminin
Homologous superfamily homologous superfamily	10 — Laminin

Domain ID domain_id	3c9aD00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	25 — Laminin
Homologous superfamily homologous superfamily	10 — Laminin

▶

Unit-cell length a length_a	49.991 Å
Unit-cell length b length_b	51.275 Å
Unit-cell length c length_c	69.985 Å
Unit-cell angle α angle_alpha	84.23 °
Unit-cell angle β angle_beta	74.82 °
Unit-cell angle γ angle_gamma	75.67 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.600 Å
Low-resolution limit resolution_low	40.760 Å
R factor r_factor	0.1980
R_work r_work	0.1950
R_free r_free	0.2400

High Resolution Crystal Structure of Argos bound to the EGF domain of Spitz

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein giant-lens

State in the Current Structure

Other States of the Same Protein in the Database

Protein spitz

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3c9a__assembly_1__model_1

3c9a__assembly_1__model_1 | I(q)

3c9a__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)

High Resolution Crystal Structure of Argos bound to the EGF domain of Spitz

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein giant-lens

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein spitz

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3c9a__assembly_1__model_1

3c9a__assembly_1__model_1 | I(q)

3c9a__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)