3cjh

Tim8-Tim13 complex

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial import inner membrane translocase subunit TIM13

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Mitochondrial import inner membrane translocase subunit TIM8 × 3 （P57744） water × 6	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Mitochondrial import inner membrane translocase subunit TIM8 × 3 （P57744） water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIM13_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–64； UniProt 42–105 Author chain C； PDBConstruct 1–64； UniProt 42–105 Author chain E； PDBConstruct 1–64； UniProt 42–105 Author chain G； PDBConstruct 1–64； UniProt 42–105 Author chain I； PDBConstruct 1–64； UniProt 42–105 Author chain K； PDBConstruct 1–64； UniProt 42–105

Mitochondrial import inner membrane translocase subunit TIM8

Saccharomyces cerevisiae

UniProt P57744

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Mitochondrial import inner membrane translocase subunit TIM13 × 3 （P53299） water × 6	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Mitochondrial import inner membrane translocase subunit TIM13 × 3 （P53299） water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TIM8_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–64； UniProt 24–87 Author chain D； PDBConstruct 1–64； UniProt 24–87 Author chain F； PDBConstruct 1–64； UniProt 24–87 Author chain H； PDBConstruct 1–64； UniProt 24–87 Author chain J； PDBConstruct 1–64； UniProt 24–87 Author chain L； PDBConstruct 1–64； UniProt 24–87

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3cjh
Deposition date deposition_date	2008-03-12
Structure title title	Tim8-Tim13 complex
Keywords keywords	;cyclic heterohexamer, Chaperone, Inner membrane, Membrane, Metal-binding, Mitochondrion, Protein transport, Translocation, Transport ;; PROTEIN TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3cjh__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3cjh__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3cjh__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.52 Å
Rg (electron density)	21.36 Å
Total Rg	22.21 Å
Atom count	2631
Residues	331
Excluded volume	46586 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3cjh__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3cjh__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Mitochondrial import inner membrane translocase subunit TIM13
Molecular weight formula_weight	7083.0 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G,I,K
Atom count atom_count	5279

AVANATELVNKISENCFEKCLTSPYATRNDACIDQCLAKYMRSWNVISKAYISRIQNASASGEI

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Mitochondrial import inner membrane translocase subunit TIM8
Molecular weight formula_weight	7342.2 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,J,L

LEGENSKQKVQMSIHQFTNICFKKCVESVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	41

▼

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

Domain ID domain_id	3cjhA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

Domain ID domain_id	3cjhB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

Domain ID domain_id	3cjhC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

Domain ID domain_id	3cjhD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

Domain ID domain_id	3cjhE00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

Domain ID domain_id	3cjhF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

Domain ID domain_id	3cjhG00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

Domain ID domain_id	3cjhH00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

Domain ID domain_id	3cjhI00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

Domain ID domain_id	3cjhJ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

Domain ID domain_id	3cjhK00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

Domain ID domain_id	3cjhL00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	810 — Mitochondrial import inner membrane translocase subunit tim13 like domains

▶

Unit-cell length a length_a	55.655 Å
Unit-cell length b length_b	56.303 Å
Unit-cell length c length_c	59.837 Å
Unit-cell angle α angle_alpha	89.18 °
Unit-cell angle β angle_beta	89.65 °
Unit-cell angle γ angle_gamma	60.30 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.600 Å
Low-resolution limit resolution_low	19.940 Å
R factor r_factor	0.2469
R_work r_work	0.2445
R_free r_free	0.2888

Tim8-Tim13 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial import inner membrane translocase subunit TIM13

State in the Current Structure

Other States of the Same Protein in the Database

Mitochondrial import inner membrane translocase subunit TIM8

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3cjh__assembly_2__model_1

3cjh__assembly_2__model_1 | I(q)

3cjh__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

7. Citations (1)

Tim8-Tim13 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial import inner membrane translocase subunit TIM13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial import inner membrane translocase subunit TIM8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3cjh__assembly_2__model_1

3cjh__assembly_2__model_1 | I(q)

3cjh__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

7. Citations (1)